Human CTSC/CPPI/DPP-I ORF/cDNA clone-Lentivirus plasmid (NM_001114173)

Cat. No.: pGMLP001862
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CTSC/CPPI/DPP-I Lentiviral expression plasmid for CTSC lentivirus packaging, CTSC lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CTSC/CPPI products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001862
Gene Name CTSC
Accession Number NM_001114173
Gene ID 1075
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 426 bp
Gene Alias CPPI,DPP-I,DPP1,DPPI,HMS,JP,JPD,PALS,PDON1,PLS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTGCTGGGCCCTCCTTGCTGCTCGCCGCCCTCCTGCTGCTTCTCTCCGGCGACGGCGCCGTGCGCTGCGACACACCTGCCAACTGCACCTATCTTGACCTGCTGGGCACCTGGGTCTTCCAGGTGGGCTCCAGCGGTTCCCAGCGCGATGTCAACTGCTCGGTTATGGGACCACAAGAAAAAAAAGTAGTGGTGTACCTTCAGAAGCTGGATACAGCATATGATGACCTTGGCAATTCTGGCCATTTCACCATCATTTACAACCAAGGCTTTGAGATTGTGTTGAATGACTACAAGTGGTTTGCCTTTTTTAAGGATGTCACTGATTTTATCAGTCATTTGTTCATGCAGCTGGGAACTGTGGGGATATATGATTTGCCACATCTGAGGAACAAACTGGCCATGAACAGACGTTGGGGCTAA
ORF Protein Sequence MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKDVTDFISHLFMQLGTVGIYDLPHLRNKLAMNRRWG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T70490-Ab Anti-CATC/ CTSC/ CPPI functional antibody
    Target Antigen GM-Tg-g-T70490-Ag CTSC protein
    ORF Viral Vector pGMLP001862 Human CTSC Lentivirus plasmid
    ORF Viral Vector vGMLP001862 Human CTSC Lentivirus particle


    Target information

    Target ID GM-T70490
    Target Name CTSC
    Gene ID 1075, 13032, 705320, 25423, 101092140, 403458, 352958, 100060401
    Gene Symbol and Synonyms CatC,CPPI,CTSC,DPP-I,DPP1,DPPI,HMS,JP,JPD,PALS,PDON1,PLS
    Uniprot Accession P53634
    Uniprot Entry Name CATC_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000109861
    Target Classification Not Available

    This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. A portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. [provided by RefSeq, Nov 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.