Human HSPB8/CMT2L/DHMN2 ORF/cDNA clone-Lentivirus plasmid (NM_014365.2)

Cat. No.: pGMLP001955
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HSPB8/CMT2L/DHMN2 Lentiviral expression plasmid for HSPB8 lentivirus packaging, HSPB8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HSPB8/CMT2L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $447.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001955
Gene Name HSPB8
Accession Number NM_014365.2
Gene ID 26353
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 591 bp
Gene Alias CMT2L,DHMN2,E2IG1,H11,HMN2,HMN2A,HSP22
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGACGGTCAGATGCCCTTCTCCTGCCACTACCCAAGCCGCCTGCGCCGAGACCCCTTCCGGGACTCTCCCCTCTCCTCTCGCCTGCTGGATGATGGCTTTGGCATGGACCCCTTCCCAGACGACTTGACAGCCTCTTGGCCCGACTGGGCTCTGCCTCGTCTCTCCTCCGCCTGGCCAGGCACCCTAAGGTCGGGCATGGTGCCCCGGGGCCCCACTGCCACCGCCAGGTTTGGGGTGCCTGCCGAGGGCAGGACCCCCCCACCCTTCCCTGGGGAGCCCTGGAAAGTGTGTGTGAATGTGCACAGCTTCAAGCCAGAGGAGTTGATGGTGAAGACCAAAGATGGATACGTGGAGGTGTCTGGCAAACATGAAGAGAAACAGCAAGAAGGTGGCATTGTTTCTAAGAACTTCACAAAGAAAATCCAGCTTCCTGCAGAGGTGGATCCTGTGACAGTATTTGCCTCACTTTCCCCAGAGGGTCTGCTGATCATCGAAGCTCCCCAGGTCCCTCCTTACTCAACATTTGGAGAGAGCAGTTTCAACAACGAGCTTCCCCAGGACAGCCAGGAAGTCACCTGTACCTGA
ORF Protein Sequence MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T35161-Ab Anti-HSPB8 monoclonal antibody
    Target Antigen GM-Tg-g-T35161-Ag HSPB8 protein
    ORF Viral Vector pGMLP001955 Human HSPB8 Lentivirus plasmid
    ORF Viral Vector pGMLP005258 Human HSPB8 Lentivirus plasmid
    ORF Viral Vector pGMPC001424 Human HSPB8 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001955 Human HSPB8 Lentivirus particle
    ORF Viral Vector vGMLP005258 Human HSPB8 Lentivirus particle


    Target information

    Target ID GM-T35161
    Target Name HSPB8
    Gene ID 26353, 80888, 574341, 113906, 101093804, 403553, 539524, 100050779
    Gene Symbol and Synonyms CMT2L,Cryac,D5Ucla4,DHMN2,E2IG1,H11,H11K,HMN2,HMN2A,HSP20-like,HSP22,HSPB8
    Uniprot Accession Q9UJY1
    Uniprot Entry Name HSPB8_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Gene Ensembl ENSG00000152137
    Target Classification Not Available

    The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.