Human Nedd8/NEDD-8 ORF/cDNA clone-Lentivirus plasmid (NM_006156.2)

Cat. No.: pGMLP001974
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human Nedd8/NEDD-8 Lentiviral expression plasmid for Nedd8 lentivirus packaging, Nedd8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NEDD8/Nedd8/NEDD-8 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001974
Gene Name Nedd8
Accession Number NM_006156.2
Gene ID 4738
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 246 bp
Gene Alias NEDD-8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTAATTAAAGTGAAGACGCTGACCGGAAAGGAGATTGAGATTGACATTGAACCTACAGACAAGGTGGAGCGAATCAAGGAGCGTGTGGAGGAGAAAGAGGGAATCCCCCCACAACAGCAGAGGCTCATCTACAGTGGCAAGCAGATGAATGATGAGAAGACAGCAGCTGATTACAAGATTTTAGGTGGTTCAGTCCTTCACCTGGTGTTGGCTCTGAGAGGAGGAGGTGGTCTTAGGCAGTGA
ORF Protein Sequence MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93995-Ab Anti-NEDD8 monoclonal antibody
    Target Antigen GM-Tg-g-T93995-Ag NEDD8 protein
    ORF Viral Vector pGMLP001974 Human Nedd8 Lentivirus plasmid
    ORF Viral Vector vGMLP001974 Human Nedd8 Lentivirus particle


    Target information

    Target ID GM-T93995
    Target Name NEDD8
    Gene ID 4738, 18002, 715763, 25490, 101080973, 480265, 286796, 100051307
    Gene Symbol and Synonyms CDK8,NEDD-8,NEDD8,Rub1
    Uniprot Accession Q15843
    Uniprot Entry Name NEDD8_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000129559
    Target Classification Not Available

    Enables ubiquitin protein ligase binding activity. Acts upstream of or within protein neddylation. Located in cytosol and nucleoplasm. Biomarker of Parkinson's disease and malignant astrocytoma. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.