Human ID2/bHLHb26/GIG8 ORF/cDNA clone-Lentivirus plasmid (NM_002166)

Cat. No.: pGMLP002123
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ID2/bHLHb26/GIG8 Lentiviral expression plasmid for ID2 lentivirus packaging, ID2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ID2/bHLHb26 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002123
Gene Name ID2
Accession Number NM_002166
Gene ID 3398
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 405 bp
Gene Alias bHLHb26,GIG8,ID2A,ID2H
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAGCCTTCAGTCCCGTGAGGTCCGTTAGGAAAAACAGCCTGTCGGACCACAGCCTGGGCATCTCCCGGAGCAAAACCCCTGTGGACGACCCGATGAGCCTGCTATACAACATGAACGACTGCTACTCCAAGCTCAAGGAGCTGGTGCCCAGCATCCCCCAGAACAAGAAGGTGAGCAAGATGGAAATCCTGCAGCACGTCATCGACTACATCTTGGACCTGCAGATCGCCCTGGACTCGCATCCCACTATTGTCAGCCTGCATCACCAGAGACCCGGGCAGAACCAGGCGTCCAGGACGCCGCTGACCACCCTCAACACGGATATCAGCATCCTGTCCTTGCAGGCTTCTGAATTCCCTTCTGAGTTAATGTCAAATGACAGCAAAGCACTGTGTGGCTGA
ORF Protein Sequence MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T68877-Ab Anti-ID2 monoclonal antibody
    Target Antigen GM-Tg-g-T68877-Ag ID2 protein
    ORF Viral Vector pGMLP002123 Human ID2 Lentivirus plasmid
    ORF Viral Vector vGMLP002123 Human ID2 Lentivirus particle


    Target information

    Target ID GM-T68877
    Target Name ID2
    Gene ID 3398, 15902, 693394, 25587, 101090256, 100686903, 505025, 100057240
    Gene Symbol and Synonyms Ac2-300,bHLHb26,GIG8,ID2,ID2A,ID2H,Idb2
    Uniprot Accession Q02363
    Uniprot Entry Name ID2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000115738
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.