Human PAQR4 ORF/cDNA clone-Lentivirus plasmid (NM_152341)

Cat. No.: pGMLP002155
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PAQR4/ Lentiviral expression plasmid for PAQR4 lentivirus packaging, PAQR4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PAQR4/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $505.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002155
Gene Name PAQR4
Accession Number NM_152341
Gene ID 124222
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 822 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTTCCTGGCCGGGCCGCGCCTGCTGGACTGGGCCAGCTCGCCGCCGCACCTGCAGTTCAATAAGTTCGTGCTGACCGGGTACCGGCCCGCCAGCAGCGGCTCGGGCTGCCTGCGCAGCCTCTTCTACCTGCACAACGAACTGGGCAACATCTACACGCACGGGCTGGCCCTGCTGGGCTTCCTGGTGCTGGTGCCAATGACCATGCCCTGGGGTCAGCTGGGCAAGGATGGCTGGCTGGGAGGCACACATTGCGTGGCCTGCCTTGCACCCCCTGCAGGCTCCGTGCTCTATCACCTCTTTATGTGCCACCAAGGGGGCAGCGCTGTGTACGCCCGGCTCCTCGCCCTGGACATGTGTGGGGTCTGCCTTGTCAACACCCTTGGGGCCCTGCCCATCATCCACTGCACCCTGGCCTGCAGGCCCTGGCTGCGCCCGGCTGCCCTGGTGGGCTACACTGTGTTGTCGGGTGTGGCCGGCTGGCGTGCTCTCACCGCCCCCTCCACCAGTGCTCGGCTCCGGGCATTTGGATGGCAGGCTGCTGCCCGCCTACTGGTATTTGGGGCCCGGGGAGTGGGTCTGGGTTCAGGGGCTCCAGGCTCCCTGCCCTGCTACCTGCGCATGGACGCACTGGCGCTGCTTGGGGGACTGGTAAATGTAGCCCGTCTGCCCGAGCGCTGGGGACCTGGCCGCTTTGACTACTGGGGCAACTCCCACCAGATCATGCACCTGCTGAGCGTGGGCTCCATCCTGCAGCTGCACGCCGGCGTCGTGCCCGACCTGCTCTGGGCTGCCCACCACGCCTGTCCCCGGGACTGA
ORF Protein Sequence MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPWGQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1324-Ab Anti-PAQR4 monoclonal antibody
    Target Antigen GM-Tg-g-IP1324-Ag PAQR4 protein
    ORF Viral Vector pGMLP002155 Human PAQR4 Lentivirus plasmid
    ORF Viral Vector vGMLP002155 Human PAQR4 Lentivirus particle


    Target information

    Target ID GM-IP1324
    Target Name PAQR4
    Gene ID 124222, 76498, 699484, 302967, 102900169, 490051, 507075, 111767587
    Gene Symbol and Synonyms 1500004C10Rik,PAQR4
    Uniprot Accession Q8N4S7
    Uniprot Entry Name PAQR4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000162073
    Target Classification Not Available

    Predicted to enable signaling receptor activity. Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.