Human H2AFZ/H2A.z/H2A.Z-1 ORF/cDNA clone-Lentivirus plasmid (NM_002106)
Cat. No.: pGMLP002323
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human H2AFZ/H2A.z/H2A.Z-1 Lentiviral expression plasmid for H2AFZ lentivirus packaging, H2AFZ lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
H2AFZ/H2A.z products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002323 |
Gene Name | H2AFZ |
Accession Number | NM_002106 |
Gene ID | 3015 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 387 bp |
Gene Alias | H2A.z,H2A.Z-1,H2A/z,H2AZ |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTGGCGGTAAGGCTGGAAAGGACTCCGGAAAGGCCAAGACAAAGGCGGTTTCCCGCTCGCAGAGAGCCGGCTTGCAGTTCCCAGTGGGCCGTATTCATCGACACCTAAAATCTAGGACGACCAGTCATGGACGTGTGGGCGCGACTGCCGCTGTGTACAGCGCAGCCATCCTGGAGTACCTCACCGCAGAGGTACTTGAACTGGCAGGAAATGCATCAAAAGACTTAAAGGTAAAGCGTATTACCCCTCGTCACTTGCAACTTGCTATTCGTGGAGATGAAGAATTGGATTCTCTCATCAAGGCTACAATTGCTGGTGGTGGTGTCATTCCACACATCCACAAATCTCTGATTGGGAAGAAAGGACAACAGAAGACTGTCTAA |
ORF Protein Sequence | MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T53766-Ab | Anti-H2AFZ monoclonal antibody |
Target Antigen | GM-Tg-g-T53766-Ag | H2AFZ protein |
ORF Viral Vector | pGMLP002323 | Human H2AFZ Lentivirus plasmid |
ORF Viral Vector | vGMLP002323 | Human H2AFZ Lentivirus particle |
Target information
Target ID | GM-T53766 |
Target Name | H2AFZ |
Gene ID | 3015, 51788, 709326, 58940, 101087401, 478493, 287016, 100146489 |
Gene Symbol and Synonyms | H2A.z,H2A.Z-1,H2A.Z1,H2A/z,H2AFZ,H2AZ,H2AZ1 |
Uniprot Accession | P0C0S5 |
Uniprot Entry Name | H2AZ_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000164032 |
Target Classification | Not Available |
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.