Human VMA21/MEAX/XMEA ORF/cDNA clone-Lentivirus plasmid (NM_001017980)

Cat. No.: pGMLP002330
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VMA21/MEAX/XMEA Lentiviral expression plasmid for VMA21 lentivirus packaging, VMA21 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to VMA21/MEAX products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002330
Gene Name VMA21
Accession Number NM_001017980
Gene ID 203547
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 306 bp
Gene Alias MEAX,XMEA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCGCCCGGATAAGGCGGCGCTGAACGCACTGCAGCCTCCTGAGTTCAGAAATGAAAGCTCATTAGCATCTACACTGAAGACGCTCCTGTTCTTCACAGCTTTAATGATCACTGTTCCTATTGGGTTATATTTCACAACTAAATCTTACATATTTGAAGGCGCCCTTGGGATGTCCAATAGGGACAGCTATTTTTACGCTGCTATTGTTGCAGTGGTCGCCGTCCATGTGGTGCTGGCCCTCTTTGTGTATGTGGCCTGGAATGAAGGCTCACGACAGTGGCGTGAAGGCAAACAGGATTAA
ORF Protein Sequence MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2259-Ab Anti-VMA21 monoclonal antibody
    Target Antigen GM-Tg-g-IP2259-Ag VMA21 protein
    ORF Viral Vector pGMLP002330 Human VMA21 Lentivirus plasmid
    ORF Viral Vector vGMLP002330 Human VMA21 Lentivirus particle


    Target information

    Target ID GM-IP2259
    Target Name VMA21
    Gene ID 203547, 67048, 704037, 501658, 101094832, 481074, 613674, 111771653
    Gene Symbol and Synonyms 2610030H06Rik,MEAX,RGD1566155,VMA21,XMEA
    Uniprot Accession Q3ZAQ7
    Uniprot Entry Name VMA21_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000160131
    Target Classification Not Available

    This gene encodes a chaperone for assembly of lysosomal vacuolar ATPase.[provided by RefSeq, Jul 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.