Human PPP3R1/CALNB1/CNB ORF/cDNA clone-Lentivirus plasmid (NM_000945)

Cat. No.: pGMLP002414
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PPP3R1/CALNB1/CNB Lentiviral expression plasmid for PPP3R1 lentivirus packaging, PPP3R1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PPP3R1/CALNB1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $428.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002414
Gene Name PPP3R1
Accession Number NM_000945
Gene ID 5534
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 513 bp
Gene Alias CALNB1,CNB,CNB1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAAATGAGGCAAGTTATCCTTTGGAAATGTGCTCACACTTTGATGCGGATGAAATTAAAAGGCTAGGAAAGAGATTTAAGAAGCTTGATTTGGACAATTCTGGTTCTTTGAGTGTGGAAGAGTTCATGTCTCTGCCTGAGTTACAACAGAATCCTTTAGTACAGCGAGTAATAGATATATTCGACACAGATGGGAATGGAGAAGTAGACTTTAAAGAATTCATTGAGGGCGTCTCTCAGTTCAGTGTCAAAGGAGATAAGGAGCAGAAATTGAGGTTTGCTTTCCGTATCTATGACATGGATAAAGATGGCTATATTTCCAATGGGGAACTCTTCCAGGTATTGAAGATGATGGTGGGGAACAATCTGAAAGATACACAGTTACAGCAAATTGTAGACAAAACCATAATAAATGCAGATAAGGATGGAGATGGAAGAATATCCTTTGAAGAATTCTGTGCTGTTGTAGGTGGCCTAGATATCCACAAAAAGATGGTGGTAGATGTGTGA
ORF Protein Sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2669-Ab Anti-PPP3R1 monoclonal antibody
    Target Antigen GM-Tg-g-IP2669-Ag PPP3R1 protein
    ORF Viral Vector pGMLP002414 Human PPP3R1 Lentivirus plasmid
    ORF Viral Vector vGMLP002414 Human PPP3R1 Lentivirus particle


    Target information

    Target ID GM-IP2669
    Target Name PPP3R1
    Gene ID 5534, 19058, 100428682, 29748, 101090344, 612559, 282321, 100061874
    Gene Symbol and Synonyms CALNB1,CaNB1,CNB,CNB1,MCIP1,PPP3R1
    Uniprot Accession P63098
    Uniprot Entry Name CANB1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000221823
    Target Classification Not Available

    Enables cyclosporin A binding activity; phosphatase binding activity; and protein domain specific binding activity. Involved in calcineurin-NFAT signaling cascade and positive regulation of transcription by RNA polymerase II. Part of calcineurin complex. Implicated in Alzheimer's disease and dilated cardiomyopathy. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.