Human CTRL/CTRL1 ORF/cDNA clone-Lentivirus plasmid (NM_001907)

Cat. No.: pGMLP002429
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CTRL/CTRL1 Lentiviral expression plasmid for CTRL lentivirus packaging, CTRL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CTRL/CTRL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $498.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002429
Gene Name CTRL
Accession Number NM_001907
Gene ID 1506
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 795 bp
Gene Alias CTRL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGCTGCTCAGCCTGACCCTAAGCCTGGTTCTCCTCGGCTCCTCCTGGGGCTGCGGCATTCCTGCCATCAAACCGGCACTGAGCTTCAGCCAGAGGATTGTCAACGGGGAGAATGCAGTGTTGGGCTCCTGGCCCTGGCAGGTGTCCCTGCAGGACAGCAGCGGCTTCCACTTCTGCGGTGGTTCTCTCATCAGCCAGTCCTGGGTGGTCACTGCTGCCCACTGCAATGTCAGCCCTGGCCGCCATTTTGTTGTCCTGGGCGAGTATGACCGATCATCAAACGCAGAGCCCTTGCAGGTTCTGTCCGTCTCTCGGGCCATTACACACCCTAGCTGGAACTCTACCACCATGAACAATGACGTGACGCTGCTGAAGCTCGCCTCGCCAGCCCAGTACACAACACGCATCTCGCCAGTTTGCCTGGCATCCTCAAACGAGGCTCTGACTGAAGGCCTCACGTGTGTCACCACCGGCTGGGGTCGCCTCAGTGGCGTGGGCAATGTGACACCAGCACATCTGCAGCAGGTGGCTTTGCCCCTGGTCACTGTGAATCAGTGCCGGCAGTACTGGGGCTCAAGTATCACTGACTCCATGATCTGTGCAGGTGGCGCAGGTGCCTCCTCGTGCCAGGGTGACTCCGGAGGCCCTCTTGTCTGCCAGAAGGGAAACACATGGGTGCTTATTGGTATTGTCTCCTGGGGCACCAAAAACTGCAATGTGCGCGCACCTGCTGTGTATACTCGAGTTAGCAAGTTCAGCACCTGGATCAACCAGGTCATAGCCTACAACTGA
ORF Protein Sequence MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0841-Ab Anti-CTRL/ CTRL1 functional antibody
    Target Antigen GM-Tg-g-SE0841-Ag CTRL protein
    ORF Viral Vector pGMLP002429 Human CTRL Lentivirus plasmid
    ORF Viral Vector vGMLP002429 Human CTRL Lentivirus particle


    Target information

    Target ID GM-SE0841
    Target Name CTRL
    Gene ID 1506, 109660, 701625, 117184, 101091067, 611100
    Gene Symbol and Synonyms 0910001G08Rik,1810004D15Rik,chymopasin,Ctra-1,Ctra1,CTRL,CTRL1,mFLJ00366
    Uniprot Accession P40313
    Uniprot Entry Name CTRL_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000141086
    Target Classification Not Available

    This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.