Human SRPRB/APMCF1 ORF/cDNA clone-Lentivirus plasmid (NM_021203)

Cat. No.: pGMLP002517
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SRPRB/APMCF1 Lentiviral expression plasmid for SRPRB lentivirus packaging, SRPRB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SRPRB/APMCF1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $504
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002517
Gene Name SRPRB
Accession Number NM_021203
Gene ID 58477
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 816 bp
Gene Alias APMCF1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCCGCGGACTCGCGCCGGGTGGCAGATGGCGGCGGTGCCGGGGGCACCTTCCAGCCCTACCTAGACACCTTGCGGCAGGAGCTGCAGCAGACGGACCCAACGCTGTTGTCAGTAGTGGTGGCGGTTCTTGCGGTGCTGCTGACGCTAGTCTTCTGGAAGTTAATCCGGAGCAGAAGGAGCAGTCAGAGAGCTGTTCTTCTTGTTGGCCTTTGTGATTCCGGGAAAACGTTGCTCTTTGTCAGGTTGTTAACAGGCCTTTATAGAGACACTCAGACGTCCATTACTGACAGCTGTGCTGTATACAGAGTCAACAATAACAGGGGCAATAGTCTGACCTTGATTGACCTTCCCGGCCATGAGAGTTTGAGGCTTCAGTTCTTAGAGCGGTTTAAGTCTTCAGCCAGGGCTATTGTGTTTGTTGTGGATAGTGCAGCATTCCAGCGAGAGGTGAAAGATGTGGCTGAGTTTCTGTATCAAGTCCTCATTGACAGTATGGGTCTGAAGAATACACCATCATTCTTAATAGCCTGCAATAAGCAAGATATTGCAATGGCAAAATCAGCAAAGTTAATTCAACAGCAGCTGGAGAAAGAACTCAACACCTTACGAGTTACCCGTTCTGCTGCCCCCAGCACACTGGACAGTTCCAGCACTGCCCCTGCTCAGCTGGGGAAGAAAGGCAAAGAGTTTGAATTCTCACAGTTGCCCCTCAAAGTGGAGTTCCTGGAGTGCAGTGCCAAGGGTGGAAGAGGGGACGTGGGCTCTGCTGACATCCAGGACTTGGAGAAATGGCTGGCTAAAATTGCCTGA
ORF Protein Sequence MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1819-Ab Anti-SRPRB monoclonal antibody
    Target Antigen GM-Tg-g-IP1819-Ag SRPRB protein
    ORF Viral Vector pGMLP002517 Human SRPRB Lentivirus plasmid
    ORF Viral Vector vGMLP002517 Human SRPRB Lentivirus particle


    Target information

    Target ID GM-IP1819
    Target Name SRPRB
    Gene ID 58477, 20818, 719024, 300965, 111562239, 102154222, 100629957
    Gene Symbol and Synonyms Ab2-417,APMCF1,Ba1-667,Cc1-8,SR-beta,SRPRB
    Uniprot Accession Q9Y5M8
    Uniprot Entry Name SRPRB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000144867
    Target Classification Not Available

    The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.