Human SEPT3/bK250D10.3/SEP3 ORF/cDNA clone-Lentivirus plasmid (NM_145733)

Cat. No.: pGMLP002536
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SEPT3/bK250D10.3/SEP3 Lentiviral expression plasmid for SEPT3 lentivirus packaging, SEPT3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SEPT3/bK250D10.3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $601.56
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002536
Gene Name SEPT3
Accession Number NM_145733
Gene ID 55964
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1077 bp
Gene Alias bK250D10.3,SEP3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCAAAGGGCTCCCAGAGACCAGGACGGACGCAGCCATGTCAGAGCTGGTGCCTGAGCCCAGGCCTAAGCCAGCGGTGCCCATGAAGCCCATGAGCATCAACTCCAACCTGCTGGGCTACATCGGCATCGACACCATCATCGAGCAGATGCGCAAGAAGACCATGAAGACCGGTTTCGACTTCAACATCATGGTCGTTGGCCAGAGTGGACTGGGCAAATCAACGCTGGTCAACACGCTCTTCAAATCCCAAGTGAGCCGCAAGGCCTCCAGCTGGAACCGGGAGGAGAAGATCCCCAAGACAGTGGAGATCAAAGCTATCGGGCATGTGATAGAGGAAGGCGGTGTCAAAATGAAGCTGACCGTCATCGACACCCCAGGCTTTGGAGACCAAATCAACAATGAAAACTGCTGGGAGCCCATTGAGAAGTACATCAATGAGCAGTACGAGAAGTTCCTGAAGGAGGAGGTCAACATCGCCAGGAAGAAACGCATCCCTGACACTCGTGTCCACTGCTGCCTTTACTTCATCTCTCCCACAGGACACTCCTTGCGACCTCTGGATCTTGAGTTCATGAAACACCTCAGCAAGGTTGTGAACATCATCCCTGTCATTGCTAAGGCTGACACCATGACCCTGGAGGAGAAGTCTGAATTCAAGCAAAGGGTTCGCAAGGAGCTTGAAGTAAATGGCATTGAATTCTACCCCCAGAAGGAATTTGATGAGGATTTGGAGGATAAGACGGAGAATGACAAAATCAGGCAGGAGAGCATGCCTTTTGCTGTGGTGGGAAGTGACAAGGAGTACCAAGTGAATGGCAAGAGGGTCCTCGGCCGAAAAACTCCATGGGGGATCATCGAAGTGGAAAACCTCAACCACTGTGAGTTTGCCCTGCTTCGAGACTTTGTCATCAGGACCCACCTCCAGGACCTCAAGGAAGTGACACACAACATCCACTATGAGACTTACAGGGCCAAGCGGCTCAATGACAATGGAGGCCTCCCTCCGGGAGAAGGCCTCCTGGGCACTGTCCTTCCACCTGTGCCAGCCACCCCCTGCCCCACTGCTGAATGA
ORF Protein Sequence MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2733-Ab Anti-SEPT3 monoclonal antibody
    Target Antigen GM-Tg-g-IP2733-Ag SEPT3 protein
    ORF Viral Vector pGMLP002536 Human SEPT3 Lentivirus plasmid
    ORF Viral Vector vGMLP002536 Human SEPT3 Lentivirus particle


    Target information

    Target ID GM-IP2733
    Target Name SEPT3
    Gene ID 55964, 24050, 712931, 56003, 101083017, 481227, 618235, 100070757
    Gene Symbol and Synonyms 3110018K01Rik,B530002E20Rik,bK250D10.3,Gm46500,SEP3,SEPT3,SEPTIN3
    Uniprot Accession Q9UH03
    Uniprot Entry Name SEPT3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000100167
    Target Classification Not Available

    This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, May 2018]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.