Human CYB5B/CYB5-M/CYPB5M ORF/cDNA clone-Lentivirus plasmid (NM_030579)

Cat. No.: pGMLP002583
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CYB5B/CYB5-M/CYPB5M Lentiviral expression plasmid for CYB5B lentivirus packaging, CYB5B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CYB5B/CYB5-M products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002583
Gene Name CYB5B
Accession Number NM_030579
Gene ID 80777
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 453 bp
Gene Alias CYB5-M,CYPB5M,OMB5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCGGTTCAATGGCGACTGCGGAAGCTAGCGGCAGCGATGGGAAAGGGCAGGAAGTCGAGACCTCAGTCACCTATTACCGGTTGGAGGAGGTGGCAAAGCGCAACTCCTTGAAGGAACTGTGGCTTGTGATCCATGGGCGAGTCTACGATGTCACCCGCTTCCTCAACGAGCACCCTGGAGGAGAAGAGGTTCTGCTGGAACAAGCTGGTGTAGATGCAAGTGAAAGCTTTGAAGATGTAGGACACTCTTCTGATGCCAGAGAAATGCTAAAGCAGTACTACATTGGTGATATCCATCCGAGTGACCTTAAACCTGAAAGTGGTAGCAAGGACCCTTCAAAAAATGATACATGCAAAAGTTGCTGGGCATATTGGATTTTACCCATCATAGGCGCTGTTCTCTTAGGTTTCCTGTACCGCTACTACACATCGGAAAGCAAATCCTCCTGA
ORF Protein Sequence MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0640-Ab Anti-CYB5B monoclonal antibody
    Target Antigen GM-Tg-g-IP0640-Ag CYB5B protein
    ORF Viral Vector pGMLP002583 Human CYB5B Lentivirus plasmid
    ORF Viral Vector vGMLP002583 Human CYB5B Lentivirus particle


    Target information

    Target ID GM-IP0640
    Target Name CYB5B
    Gene ID 80777, 66427, 705093, 80773, 101083640, 610942, 506370, 100067168
    Gene Symbol and Synonyms 1810044O22Rik,CYB5-M,CYB5B,Cyb5m,CYPB5M,LOC101083640,OMB5
    Uniprot Accession O43169
    Uniprot Entry Name CYB5B_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000103018
    Target Classification Not Available

    Enables heme binding activity. Contributes to nitrite reductase (NO-forming) activity. Involved in nitric oxide biosynthetic process. Located in membrane. Part of nitric-oxide synthase complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.