Human SMIM12/C1orf212 ORF/cDNA clone-Lentivirus plasmid (NM_138428)

Cat. No.: pGMLP002621
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SMIM12/C1orf212 Lentiviral expression plasmid for SMIM12 lentivirus packaging, SMIM12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SMIM12/C1orf212 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002621
Gene Name SMIM12
Accession Number NM_138428
Gene ID 113444
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 279 bp
Gene Alias C1orf212
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGCCTGTGTTTTGGACCGTGGTTCGTACCTATGCTCCTTATGTCACATTCCCTGTTGCCTTCGTGGTCGGGGCTGTGGGTTACCACCTGGAATGGTTCATCAGGGGAAAGGACCCCCAGCCCGTGGAGGAGGAAAAGAGCATCTCAGAGCGCCGGGAGGATCGCAAGCTGGATGAGCTTCTAGGCAAGGACCACACGCAGGTGGTGAGCCTTAAGGACAAGCTAGAATTTGCCCCGAAAGCTGTGCTGAACAGAAACCGCCCAGAGAAGAATTAA
ORF Protein Sequence MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1763-Ab Anti-SMIM12 monoclonal antibody
    Target Antigen GM-Tg-g-IP1763-Ag SMIM12 protein
    ORF Viral Vector pGMLP002621 Human SMIM12 Lentivirus plasmid
    ORF Viral Vector vGMLP002621 Human SMIM12 Lentivirus particle


    Target information

    Target ID GM-IP1763
    Target Name SMIM12
    Gene ID 113444, 80284, 712003, 685634, 101084299, 100682960, 512753, 100069744
    Gene Symbol and Synonyms C15H1orf212,C1H1orf212,C1orf212,C3H1orf212,CC1H1orf212,SMIM12
    Uniprot Accession Q96EX1
    Uniprot Entry Name SIM12_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000163866
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.