Human C12orf49 ORF/cDNA clone-Lentivirus plasmid (NM_024738)

Cat. No.: pGMLP002625
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human C12orf49/ Lentiviral expression plasmid for C12orf49 lentivirus packaging, C12orf49 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to C12orf49/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $454.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002625
Gene Name C12orf49
Accession Number NM_024738
Gene ID 79794
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 618 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGAACCTGGCGGCCATGGTGTGGCGCCGGCTTCTGCGGAAGAGGTGGGTGCTCGCCCTGGTCTTCGGGCTGTCGCTCGTCTACTTCCTCAGCAGCACCTTCAAGCAGGAGGAGAGGGCAGTGAGAGATAGGAATCTCCTCCAGGTTCATGACCATAATCAGCCCATCCCGTGGAAAGTGCAGTTTAACTTGGGCAATAGCAGTCGTCCGAGCAATCAGTGCCGCAACTCCATTCAAGGGAAGCACCTCATCACGGATGAACTCGGCTACGTTTGCGAGAGGAAGGATTTGCTGGTAAATGGCTGCTGTAATGTCAACGTCCCTAGCACGAAGCAGTACTGCTGTGATGGCTGCTGGCCCAACGGCTGCTGCAGCGCCTATGAGTACTGTGTCTCCTGCTGCCTGCAGCCCAACAAGCAACTTCTCCTGGAGCGCTTCCTCAACCGGGCAGCCGTGGCATTCCAGAACCTCTTCATGGCAGTCGAAGATCACTTTGAGTTGTGCCTGGCCAAATGCAGGACCTCATCTCAGAGCGTGCAGCATGAGAACACCTACCGGGACCCCATAGCAAAGTATTGCTATGGAGAAAGCCCGCCCGAGCTCTTCCCCGCTTGA
ORF Protein Sequence MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0050-Ab Anti-SPRNG/ C12orf49 functional antibody
    Target Antigen GM-Tg-g-SE0050-Ag C12orf49 protein
    ORF Viral Vector pGMLP002625 Human C12orf49 Lentivirus plasmid
    ORF Viral Vector vGMLP002625 Human C12orf49 Lentivirus particle


    Target information

    Target ID GM-SE0050
    Target Name C12orf49
    Gene ID 79794, 76792, 713916, 498188, 101099840, 483437, 534423, 106783489
    Gene Symbol and Synonyms 2410131K14Rik,C11H12orf49,C12orf49,C17H12orf49,C26H12orf49,C8H12orf49,C9H12orf49,CD3H12orf49,LUR1,POST1,RGD1562310,SPRING,SPRING1
    Uniprot Accession Q9H741
    Uniprot Entry Name SPRNG_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000111412
    Target Classification Not Available

    Involved in positive regulation of SREBP signaling pathway. Located in Golgi membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.