Human ALOX5AP/FLAP ORF/cDNA clone-Lentivirus plasmid (NM_001629)

Cat. No.: pGMLP002710
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ALOX5AP/FLAP Lentiviral expression plasmid for ALOX5AP lentivirus packaging, ALOX5AP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FLAP/ALOX5AP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002710
Gene Name ALOX5AP
Accession Number NM_001629
Gene ID 241
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 486 bp
Gene Alias FLAP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATCAAGAAACTGTAGGCAATGTTGTCCTGTTGGCCATCGTCACCCTCATCAGCGTGGTCCAGAATGGATTCTTTGCCCATAAAGTGGAGCACGAAAGCAGGACCCAGAATGGGAGGAGCTTCCAGAGGACCGGAACACTTGCCTTTGAGCGGGTCTACACTGCCAACCAGAACTGTGTAGATGCGTACCCCACTTTCCTCGCTGTGCTCTGGTCTGCGGGGCTACTTTGCAGCCAAGTTCCTGCTGCGTTTGCTGGACTGATGTACTTGTTTGTGAGGCAAAAGTACTTTGTCGGTTACCTAGGAGAGAGAACGCAGAGCACCCCTGGCTACATATTTGGGAAACGCATCATACTCTTCCTGTTCCTCATGTCCGTTGCTGGCATATTCAACTATTACCTCATCTTCTTTTTCGGAAGTGACTTTGAAAACTACATAAAGACGATCTCCACCACCATCTCCCCTCTACTTCTCATTCCCTAA
ORF Protein Sequence MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0099-Ab Anti-FLAP monoclonal antibody
    Target Antigen GM-Tg-g-IP0099-Ag FLAP/ALOX5AP protein
    ORF Viral Vector pGMLP002710 Human ALOX5AP Lentivirus plasmid
    ORF Viral Vector vGMLP002710 Human ALOX5AP Lentivirus particle


    Target information

    Target ID GM-IP0099
    Target Name FLAP
    Gene ID 241, 11690, 713170, 29624, 101090316, 613869, 100034178
    Gene Symbol and Synonyms ALOX5AP,FLAP
    Uniprot Accession P20292
    Uniprot Entry Name AL5AP_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000132965
    Target Classification Not Available

    This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.