Human BIRC7/KIAP/LIVIN ORF/cDNA clone-Lentivirus plasmid (NM_022161)

Cat. No.: pGMLP002724
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BIRC7/KIAP/LIVIN Lentiviral expression plasmid for BIRC7 lentivirus packaging, BIRC7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ML-IAP/BIRC7/KIAP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $510.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002724
Gene Name BIRC7
Accession Number NM_022161
Gene ID 79444
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 843 bp
Gene Alias KIAP,LIVIN,ML-IAP,MLIAP,RNF50
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGACCTAAAGACAGTGCCAAGTGCCTGCACCGTGGACCACAGCCGAGCCACTGGGCAGCCGGTGATGGTCCCACGCAGGAGCGCTGTGGACCCCGCTCTCTGGGCAGCCCTGTCCTAGGCCTGGACACCTGCAGAGCCTGGGACCACGTGGATGGGCAGATCCTGGGCCAGCTGCGGCCCCTGACAGAGGAGGAAGAGGAGGAGGGCGCCGGGGCCACCTTGTCCAGGGGGCCTGCCTTCCCCGGCATGGGCTCTGAGGAGTTGCGTCTGGCCTCCTTCTATGACTGGCCGCTGACTGCTGAGGTGCCACCCGAGCTGCTGGCTGCTGCCGGCTTCTTCCACACAGGCCATCAGGACAAGGTGAGGTGCTTCTTCTGCTATGGGGGCCTGCAGAGCTGGAAGCGCGGGGACGACCCCTGGACGGAGCATGCCAAGTGGTTCCCCAGCTGTCAGTTCCTGCTCCGGTCAAAAGGAAGAGACTTTGTCCACAGTGTGCAGGAGACTCACTCCCAGCTGCTGGGCTCCTGGGACCCGTGGGAAGAACCGGAAGACGCAGCCCCTGTGGCCCCCTCCGTCCCTGCCTCTGGGTACCCTGAGCTGCCCACACCCAGGAGAGAGGTCCAGTCTGAAAGTGCCCAGGAGCCAGGAGCCAGGGATGTGGAGGCGCAGCTGCGGCGGCTGCAGGAGGAGAGGACGTGCAAGGTGTGCCTGGACCGCGCCGTGTCCATCGTCTTTGTGCCGTGCGGCCACCTGGTCTGTGCTGAGTGTGCCCCCGGCCTGCAGCTGTGCCCCATCTGCAGAGCCCCCGTCCGCAGCCGCGTGCGCACCTTCCTGTCCTAG
ORF Protein Sequence MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T42247-Ab Anti-ML-IAP monoclonal antibody
    Target Antigen GM-Tg-g-T42247-Ag ML-IAP/BIRC7 protein
    ORF Viral Vector pGMLP002724 Human BIRC7 Lentivirus plasmid
    ORF Viral Vector pGMPC000540 Human BIRC7 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002724 Human BIRC7 Lentivirus particle


    Target information

    Target ID GM-T42247
    Target Name ML-IAP
    Gene ID 79444, 329581, 697671, 296468, 101080371, 485969, 514508, 100147373
    Gene Symbol and Synonyms BIRC7,E130019N06,KIAP,LIVIN,ML-IAP,MLIAP,RGD1562883,RNF50
    Uniprot Accession Q96CA5
    Uniprot Entry Name BIRC7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000101197
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.