Human CRHBP/CRF-BP/CRFBP ORF/cDNA clone-Lentivirus plasmid (NM_001882)

Cat. No.: pGMLP002743
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CRHBP/CRF-BP/CRFBP Lentiviral expression plasmid for CRHBP lentivirus packaging, CRHBP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CRHBP/CRF-BP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $542.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002743
Gene Name CRHBP
Accession Number NM_001882
Gene ID 1393
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 969 bp
Gene Alias CRF-BP,CRFBP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCCCAACTTCAAACTTCAGTGTCACTTCATTCTCATCTTCCTGACGGCTCTAAGAGGGGAAAGCCGGTACCTAGAGCTGAGGGAAGCGGCGGACTACGATCCTTTCCTGCTCTTCAGCGCCAACCTGAAGCGGGAGCTGGCTGGGGAGCAGCCGTACCGCCGCGCTCTGCGGTGCCTGGACATGCTGAGCCTCCAGGGCCAGTTCACCTTCACCGCCGACCGGCCGCAGCTGCACTGCGCAGCCTTCTTCATCAGCGAGCCCGAGGAGTTCATTACCATCCACTACGACCAGGTCTCCATCGACTGTCAGGGCGGCGACTTCCTGAAGGTATTTGATGGTTGGATTCTCAAGGGGGAGAAGTTCCCCAGTTCCCAGGATCATCCTCTCCCCTCAGCTGAGCGGTACATAGATTTCTGTGAGAGTGGTCTTAGCAGGAGGAGCATCAGATCTTCCCAGAATGTGGCCATGATCTTCTTCCGAGTCCATGAACCAGGAAATGGATTCACATTAACCATAAAGACAGACCCCAACCTCTTTCCTTGCAATGTCATTTCTCAGACTCCAAATGGAAAGTTTACCCTGGTAGTTCCACACCAGCATCGAAACTGCAGCTTCTCCATAATTTATCCTGTGGTGATCAAAATATCTGATCTTACCCTGGGACACGTAAATGGTCTTCAGTTAAAGAAATCCTCAGCAGGTTGCGAGGGAATAGGAGACTTTGTGGAGCTGCTGGGAGGAACTGGATTGGACCCTTCCAAGATGACGCCTTTAGCTGATCTCTGCTACCCCTTTCATGGCCCGGCCCAGATGAAAGTTGGCTGTGACAACACTGTGGTGCGCATGGTCTCCAGTGGAAAACACGTAAATCGTGTGACTTTTGAGTATCGTCAGCTGGAGCCGTACGAGCTGGAAAACCCAAATGGAAACAGTATCGGGGAATTCTGTTTGTCTGGTCTTTGA
ORF Protein Sequence MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T36423-Ab Anti-CRHBP/ CRF-BP/ CRFBP functional antibody
    Target Antigen GM-Tg-g-T36423-Ag CRHBP protein
    ORF Viral Vector pGMLP002743 Human CRHBP Lentivirus plasmid
    ORF Viral Vector vGMLP002743 Human CRHBP Lentivirus particle


    Target information

    Target ID GM-T36423
    Target Name CRHBP
    Gene ID 1393, 12919, 707589, 29625, 101083142, 610584, 540087, 100073275
    Gene Symbol and Synonyms CRF-BP,CRFBP,CRH-BP,CRHBP
    Uniprot Accession P24387
    Uniprot Entry Name CRHBP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000145708
    Target Classification Not Available

    Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.