Human NAPG/GAMMASNAP ORF/cDNA clone-Lentivirus plasmid (NM_003826)

Cat. No.: pGMLP002784
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NAPG/GAMMASNAP Lentiviral expression plasmid for NAPG lentivirus packaging, NAPG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NAPG/GAMMASNAP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $534.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002784
Gene Name NAPG
Accession Number NM_003826
Gene ID 8774
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 939 bp
Gene Alias GAMMASNAP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCTCAGAAGATAAACGAGGGGCTGGAACACCTCGCCAAAGCAGAGAAATACCTGAAAACTGGTTTTTTAAAATGGAAGCCAGATTATGACAGTGCCGCTTCTGAATATGGAAAAGCAGCTGTTGCTTTTAAAAATGCCAAACAGTTTGAGCAAGCAAAAGATGCCTGCCTGAGGGAAGCTGTTGCCCATGAAAATAATAGGGCTCTTTTTCATGCTGCCAAAGCTTATGAGCAAGCTGGAATGATGTTGAAGGAGATGCAGAAACTACCAGAGGCCGTTCAGCTAATTGAGAAGGCCAGCATGATGTATCTAGAAAACGGCACCCCAGACACAGCAGCCATGGCTTTGGAGCGAGCTGGAAAGCTTATAGAAAATGTTGATCCAGAGAAGGCTGTACAGTTATATCAACAGACAGCTAATGTGTTTGAAAATGAAGAACGCTTACGACAGGCAGTTGAATTACTAGGAAAAGCCTCCAGACTACTAGTACGAGGACGTAGGTTTGATGAGGCGGCACTCTCTATTCAGAAAGAAAAAAATATTTATAAGGAAATTGAGAATTATCCAACTTGTTATAAGAAAACAATTGCTCAAGTCTTAGTTCATCTACACAGAAATGACTATGTAGCTGCAGAAAGATGTGTCCGGGAGAGCTATAGCATCCCTGGGTTCAATGGCAGTGAAGACTGTGCTGCCCTGGAACAGCTTCTTGAAGGTTATGACCAGCAAGACCAAGATCAGGTGTCAGATGTCTGCAACTCACCGCTTTTCAAGTACATGGACAATGATTATGCTAAGCTGGGCCTGAGTTTGGTGGTTCCAGGAGGGGGAATCAAGAAGAAATCACCTGCAACACCACAGGCCAAGCCTGATGGTGTCACTGCCACGGCTGCTGATGAAGAGGAAGATGAATACTCAGGAGGACTATGCTAG
ORF Protein Sequence MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2623-Ab Anti-NAPG monoclonal antibody
    Target Antigen GM-Tg-g-IP2623-Ag NAPG protein
    ORF Viral Vector pGMLP002784 Human NAPG Lentivirus plasmid
    ORF Viral Vector vGMLP002784 Human NAPG Lentivirus particle


    Target information

    Target ID GM-IP2623
    Target Name NAPG
    Gene ID 8774, 108123, 704546, 307382, 101099595, 608647, 509041, 100050057
    Gene Symbol and Synonyms 2400003O04Rik,GAMMASNAP,NAPG,SNARE
    Uniprot Accession Q99747
    Uniprot Entry Name SNAG_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000134265
    Target Classification Not Available

    This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular membrane fusion apparatus, and their action at specific sites of fusion must be controlled by SNAP receptors particular to the membranes being fused. The product of this gene mediates platelet exocytosis and controls the membrane fusion events of this process.[provided by RefSeq, Dec 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.