Human LEPROT/LEPR/OB-RGRP ORF/cDNA clone-Lentivirus plasmid (NM_001198681)

Cat. No.: pGMLP002861
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LEPROT/LEPR/OB-RGRP Lentiviral expression plasmid for LEPROT lentivirus packaging, LEPROT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LEPROT/LEPR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002861
Gene Name LEPROT
Accession Number NM_001198681
Gene ID 54741
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 423 bp
Gene Alias LEPR,OB-RGRP,OBRGRP,VPS55
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGAGACGGAAAAGGTTTTTTGCAAGGCTTCCTGTATTTTGCTCTCGTGGCATTATCCTTCAGTGGGGCTATTGGACTGACTTTTCTTATGCTGGGATGTGCCTTAGAGGATTATGGCGTTTACTGGCCCTTATTCGTCCTGATTTTCCACGCCATCTCCCCCATCCCCCATTTCATTGCCAAAAGAGTCACCTATGACTCAGATGCAACCAGTAGTGCCTGTCGGGAACTGGCATATTTCTTCACTACTGGAATTGTTGTTTCTGCCTTTGGATTTCCTGTTATTCTTGCTCGTGTGGCTGTGATCAAATGGGGAGCCTGCGGCCTTGTGTTGGCAGGCAATGCAGTCATTTTCCTTACAATTCAAGGGTTTTTCCTTATATTTGGAAGAGGAGATGATTTTAGCTGGGAGCAGTGGTAG
ORF Protein Sequence MRDGKGFLQGFLYFALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1080-Ab Anti-LEPROT monoclonal antibody
    Target Antigen GM-Tg-g-IP1080-Ag LEPROT protein
    ORF Viral Vector pGMLP002861 Human LEPROT Lentivirus plasmid
    ORF Viral Vector vGMLP002861 Human LEPROT Lentivirus particle


    Target information

    Target ID GM-IP1080
    Target Name LEPROT
    Gene ID 54741, 230514, 703005, 56766, 101085391, 609115, 613665, 100630509
    Gene Symbol and Synonyms LEPR,LEPROT,OB-RGRP,OBRGRP,VPS55
    Uniprot Accession O15243
    Uniprot Entry Name OBRG_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000213625
    Target Classification Not Available

    LEPROT is associated with the Golgi complex and endosomes and has a role in cell surface expression of growth hormone receptor (GHR; MIM 600946) and leptin receptor (OBR, or LEPR; MIM 601007), thereby altering receptor-mediated cell signaling (Couturier et al., 2007 [PubMed 18042720]; Touvier et al., 2009 [PubMed 19907080]).[supplied by OMIM, Jul 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.