Human GUCA1A/C6orf131/COD3 ORF/cDNA clone-Lentivirus plasmid (NM_000409)

Cat. No.: pGMLP002978
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GUCA1A/C6orf131/COD3 Lentiviral expression plasmid for GUCA1A lentivirus packaging, GUCA1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GUCA1A/C6orf131 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $451.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP002978
Gene Name GUCA1A
Accession Number NM_000409
Gene ID 2978
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 606 bp
Gene Alias C6orf131,COD3,CORD14,GCAP,GCAP1,GUCA,GUCA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAACGTGATGGAGGGAAAGTCAGTGGAGGAGCTGAGCAGCACCGAGTGCCACCAGTGGTACAAGAAGTTCATGACTGAGTGCCCCTCTGGCCAACTCACCCTCTATGAGTTCCGCCAGTTCTTCGGCCTCAAGAACCTGAGCCCGTCGGCCAGCCAGTACGTGGAACAGATGTTTGAGACTTTTGACTTCAACAAGGACGGCTACATTGATTTCATGGAGTACGTGGCAGCGCTCAGCTTGGTCCTCAAGGGGAAGGTGGAACAGAAGCTCCGCTGGTACTTCAAGCTCTATGATGTAGATGGCAACGGCTGCATTGACCGCGATGAGCTGCTCACCATCATCCAGGCCATTCGCGCCATTAACCCCTGCAGCGATACCACCATGACTGCAGAGGAGTTCACCGATACAGTGTTCTCCAAGATTGACGTCAACGGGGATGGGGAACTCTCCCTGGAAGAGTTTATAGAGGGCGTCCAGAAGGACCAGATGCTCCTGGACACACTGACACGAAGCCTGGACCTTACCCGCATCGTGCGCAGGCTCCAGAATGGCGAGCAAGACGAGGAGGGGGCTGACGAGGCCGCTGAGGCAGCCGGCTGA
ORF Protein Sequence MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2535-Ab Anti-GUCA1A monoclonal antibody
    Target Antigen GM-Tg-g-IP2535-Ag GUCA1A protein
    ORF Viral Vector pGMLP002978 Human GUCA1A Lentivirus plasmid
    ORF Viral Vector vGMLP002978 Human GUCA1A Lentivirus particle


    Target information

    Target ID GM-IP2535
    Target Name GUCA1A
    Gene ID 2978, 14913, 695552, 301233, 101080382, 609180, 282243, 100066702
    Gene Symbol and Synonyms C6orf131,COD3,CORD14,GC-A,GCAP,GCAP-1,GCAP-I,GCAP1,GUCA,GUCA1,GUCA1A,mGCAP1
    Uniprot Accession P43080
    Uniprot Entry Name GUC1A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000048545
    Target Classification Not Available

    This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. provided by RefSeq, Jul 2020]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.