Human GUCA1A/C6orf131/COD3 ORF/cDNA clone-Lentivirus plasmid (NM_000409)
Cat. No.: pGMLP002978
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GUCA1A/C6orf131/COD3 Lentiviral expression plasmid for GUCA1A lentivirus packaging, GUCA1A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
GUCA1A/C6orf131 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002978 |
Gene Name | GUCA1A |
Accession Number | NM_000409 |
Gene ID | 2978 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 606 bp |
Gene Alias | C6orf131,COD3,CORD14,GCAP,GCAP1,GUCA,GUCA1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCAACGTGATGGAGGGAAAGTCAGTGGAGGAGCTGAGCAGCACCGAGTGCCACCAGTGGTACAAGAAGTTCATGACTGAGTGCCCCTCTGGCCAACTCACCCTCTATGAGTTCCGCCAGTTCTTCGGCCTCAAGAACCTGAGCCCGTCGGCCAGCCAGTACGTGGAACAGATGTTTGAGACTTTTGACTTCAACAAGGACGGCTACATTGATTTCATGGAGTACGTGGCAGCGCTCAGCTTGGTCCTCAAGGGGAAGGTGGAACAGAAGCTCCGCTGGTACTTCAAGCTCTATGATGTAGATGGCAACGGCTGCATTGACCGCGATGAGCTGCTCACCATCATCCAGGCCATTCGCGCCATTAACCCCTGCAGCGATACCACCATGACTGCAGAGGAGTTCACCGATACAGTGTTCTCCAAGATTGACGTCAACGGGGATGGGGAACTCTCCCTGGAAGAGTTTATAGAGGGCGTCCAGAAGGACCAGATGCTCCTGGACACACTGACACGAAGCCTGGACCTTACCCGCATCGTGCGCAGGCTCCAGAATGGCGAGCAAGACGAGGAGGGGGCTGACGAGGCCGCTGAGGCAGCCGGCTGA |
ORF Protein Sequence | MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2535-Ab | Anti-GUCA1A monoclonal antibody |
Target Antigen | GM-Tg-g-IP2535-Ag | GUCA1A protein |
ORF Viral Vector | pGMLP002978 | Human GUCA1A Lentivirus plasmid |
ORF Viral Vector | vGMLP002978 | Human GUCA1A Lentivirus particle |
Target information
Target ID | GM-IP2535 |
Target Name | GUCA1A |
Gene ID | 2978, 14913, 695552, 301233, 101080382, 609180, 282243, 100066702 |
Gene Symbol and Synonyms | C6orf131,COD3,CORD14,GC-A,GCAP,GCAP-1,GCAP-I,GCAP1,GUCA,GUCA1,GUCA1A,mGCAP1 |
Uniprot Accession | P43080 |
Uniprot Entry Name | GUC1A_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000048545 |
Target Classification | Not Available |
This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. provided by RefSeq, Jul 2020]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.