Human MMD/MMA/MMD1 ORF/cDNA clone-Lentivirus plasmid (NM_012329)

Cat. No.: pGMLP003014
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MMD/MMA/MMD1 Lentiviral expression plasmid for MMD lentivirus packaging, MMD lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MMD/MMA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $479.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003014
Gene Name MMD
Accession Number NM_012329
Gene ID 23531
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 717 bp
Gene Alias MMA,MMD1,PAQR11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGTTCAAGAATCGATTCCAGCGGTTCATGAACCATCGAGCTCCAGCCAATGGCCGCTACAAGCCAACTTGCTATGAACATGCTGCTAACTGTTACACACACGCATTCCTCATTGTTCCGGCCATCGTGGGCAGTGCCCTCCTCCATCGGCTGTCTGATGACTGCTGGGAAAAGATAACAGCATGGATTTATGGAATGGGACTCTGTGCCCTCTTCATCGTTTCTACAGTATTTCACATTGTATCATGGAAAAAGAGCCACTTAAGGACAGTGGAGCATTGTTTTCACATGTGTGATAGAATGGTTATCTATTTCTTCATTGCTGCTTCTTATGCTCCATGGTTAAATCTTCGTGAACTTGGACCCCTGGCATCTCATATGCGTTGGTTTATCTGGCTCATGGCAGCTGGAGGAACCATTTATGTATTTCTCTACCATGAAAAATATAAGGTGGTTGAACTCTTTTTCTATCTCACAATGGGATTCTCTCCAGCCTTGGTGGTGACATCAATGAACAACACCGATGGACTTCAGGAACTTGCCTGTGGGGGCTTAATTTATTGCTTGGGAGTTGTGTTCTTCAAGAGTGATGGCATCATTCCATTTGCCCACGCCATCTGGCACCTGTTTGTGGCCACGGCAGCTGCAGTGCATTACTACGCCATTTGGAAATACCTTTACCGAAGTCCTACGGACTTTATGCGGCATTTATGA
ORF Protein Sequence MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1197-Ab Anti-MMD monoclonal antibody
    Target Antigen GM-Tg-g-IP1197-Ag MMD protein
    ORF Viral Vector pGMLP003014 Human MMD Lentivirus plasmid
    ORF Viral Vector vGMLP003014 Human MMD Lentivirus particle


    Target information

    Target ID GM-IP1197
    Target Name MMD
    Gene ID 23531, 67468, 706723, 303439, 101085331, 480562, 513155, 100070559
    Gene Symbol and Synonyms 1200017E07Rik,1810073C06Rik,Maf,MMA,MMD,MMD1,PAQR11
    Uniprot Accession Q15546
    Uniprot Entry Name PAQRB_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000108960
    Target Classification Not Available

    This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been positively identified as a receptor. A suggested alternative function is that of an ion channel protein in maturing macrophages. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.