Human SLC25A3/OK/SW-cl.48/PHC ORF/cDNA clone-Lentivirus plasmid (NM_002635)
Cat. No.: pGMLP003016
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SLC25A3/OK/SW-cl.48/PHC Lentiviral expression plasmid for SLC25A3 lentivirus packaging, SLC25A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
SLC25A3/OK/SW-cl.48 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003016 |
Gene Name | SLC25A3 |
Accession Number | NM_002635 |
Gene ID | 5250 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1086 bp |
Gene Alias | OK/SW-cl.48,PHC,PTP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTTCTCGTCCGTGGCGCACCTGGCGCGGGCGAACCCCTTCAACACGCCACATCTGCAGCTGGTGCACGATGGTCTCGGGGACCTCCGCAGCAGCTCCCCAGGGCCCACGGGCCAGCCCCGCCGCCCTCGCAACCTGGCAGCCGCCGCCGTGGAAGAGTACAGTTGTGAATTTGGCTCCGCGAAGTATTATGCACTGTGTGGCTTTGGTGGGGTCTTAAGTTGTGGTCTGACACACACTGCTGTGGTTCCCCTGGATTTAGTGAAATGCCGTATGCAGGTGGACCCCCAAAAGTACAAGGGCATATTTAACGGATTCTCAGTTACACTTAAAGAGGATGGTGTTCGTGGTTTGGCTAAAGGATGGGCTCCGACTTTCCTTGGCTACTCCATGCAGGGACTCTGCAAGTTTGGCTTTTATGAAGTCTTTAAAGTCTTGTATAGCAATATGCTTGGAGAGGAGAATACTTATCTCTGGCGCACATCACTATATTTGGCTGCCTCTGCCAGTGCTGAATTCTTTGCTGACATTGCCCTGGCTCCTATGGAAGCTGCTAAGGTTCGAATTCAAACCCAGCCAGGTTATGCCAACACTTTGAGGGATGCAGCTCCCAAAATGTATAAGGAAGAAGGCCTAAAAGCATTCTACAAGGGGGTTGCTCCTCTCTGGATGAGACAGATACCATACACCATGATGAAGTTCGCCTGCTTTGAACGTACTGTTGAAGCACTGTACAAGTTTGTGGTTCCTAAGCCCCGCAGTGAATGTTCAAAGCCAGAGCAGCTGGTTGTAACATTTGTAGCAGGTTACATAGCTGGAGTCTTTTGTGCAATTGTTTCTCACCCTGCTGATTCTGTGGTATCTGTGTTGAATAAAGAAAAAGGTAGCAGTGCTTCTCTGGTCCTCAAGAGACTTGGATTTAAAGGTGTATGGAAGGGACTGTTTGCCCGTATCATCATGATTGGTACCCTGACTGCACTACAGTGGTTTATCTATGACTCCGTGAAGGTCTACTTCAGACTTCCTCGCCCTCCTCCACCCGAGATGCCAGAGTCTCTGAAGAAGAAGCTTGGGTTAACTCAGTAG |
ORF Protein Sequence | MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1673-Ab | Anti-SLC25A3 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1673-Ag | SLC25A3 protein |
ORF Viral Vector | pGMLP003016 | Human SLC25A3 Lentivirus plasmid |
ORF Viral Vector | vGMLP003016 | Human SLC25A3 Lentivirus particle |
Target information
Target ID | GM-IP1673 |
Target Name | SLC25A3 |
Gene ID | 5250, 18674, 693780, 245959, 101085478, 475436, 282477, 100066269 |
Gene Symbol and Synonyms | 5730556H19Rik,D1S155E,OK/SW-cl.48,PHC,PiC,PTP,SLC25A3 |
Uniprot Accession | Q00325 |
Uniprot Entry Name | MPCP_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000075415 |
Target Classification | Not Available |
The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.