Human SLC25A3/OK/SW-cl.48/PHC ORF/cDNA clone-Lentivirus plasmid (NM_002635)

Cat. No.: pGMLP003016
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLC25A3/OK/SW-cl.48/PHC Lentiviral expression plasmid for SLC25A3 lentivirus packaging, SLC25A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SLC25A3/OK/SW-cl.48 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $604.08
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003016
Gene Name SLC25A3
Accession Number NM_002635
Gene ID 5250
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1086 bp
Gene Alias OK/SW-cl.48,PHC,PTP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCTCGTCCGTGGCGCACCTGGCGCGGGCGAACCCCTTCAACACGCCACATCTGCAGCTGGTGCACGATGGTCTCGGGGACCTCCGCAGCAGCTCCCCAGGGCCCACGGGCCAGCCCCGCCGCCCTCGCAACCTGGCAGCCGCCGCCGTGGAAGAGTACAGTTGTGAATTTGGCTCCGCGAAGTATTATGCACTGTGTGGCTTTGGTGGGGTCTTAAGTTGTGGTCTGACACACACTGCTGTGGTTCCCCTGGATTTAGTGAAATGCCGTATGCAGGTGGACCCCCAAAAGTACAAGGGCATATTTAACGGATTCTCAGTTACACTTAAAGAGGATGGTGTTCGTGGTTTGGCTAAAGGATGGGCTCCGACTTTCCTTGGCTACTCCATGCAGGGACTCTGCAAGTTTGGCTTTTATGAAGTCTTTAAAGTCTTGTATAGCAATATGCTTGGAGAGGAGAATACTTATCTCTGGCGCACATCACTATATTTGGCTGCCTCTGCCAGTGCTGAATTCTTTGCTGACATTGCCCTGGCTCCTATGGAAGCTGCTAAGGTTCGAATTCAAACCCAGCCAGGTTATGCCAACACTTTGAGGGATGCAGCTCCCAAAATGTATAAGGAAGAAGGCCTAAAAGCATTCTACAAGGGGGTTGCTCCTCTCTGGATGAGACAGATACCATACACCATGATGAAGTTCGCCTGCTTTGAACGTACTGTTGAAGCACTGTACAAGTTTGTGGTTCCTAAGCCCCGCAGTGAATGTTCAAAGCCAGAGCAGCTGGTTGTAACATTTGTAGCAGGTTACATAGCTGGAGTCTTTTGTGCAATTGTTTCTCACCCTGCTGATTCTGTGGTATCTGTGTTGAATAAAGAAAAAGGTAGCAGTGCTTCTCTGGTCCTCAAGAGACTTGGATTTAAAGGTGTATGGAAGGGACTGTTTGCCCGTATCATCATGATTGGTACCCTGACTGCACTACAGTGGTTTATCTATGACTCCGTGAAGGTCTACTTCAGACTTCCTCGCCCTCCTCCACCCGAGATGCCAGAGTCTCTGAAGAAGAAGCTTGGGTTAACTCAGTAG
ORF Protein Sequence MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1673-Ab Anti-SLC25A3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1673-Ag SLC25A3 protein
    ORF Viral Vector pGMLP003016 Human SLC25A3 Lentivirus plasmid
    ORF Viral Vector vGMLP003016 Human SLC25A3 Lentivirus particle


    Target information

    Target ID GM-IP1673
    Target Name SLC25A3
    Gene ID 5250, 18674, 693780, 245959, 101085478, 475436, 282477, 100066269
    Gene Symbol and Synonyms 5730556H19Rik,D1S155E,OK/SW-cl.48,PHC,PiC,PTP,SLC25A3
    Uniprot Accession Q00325
    Uniprot Entry Name MPCP_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000075415
    Target Classification Not Available

    The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.