Human CRYBB1/CATCN3/CTRCT17 ORF/cDNA clone-Lentivirus plasmid (NM_001887)

Cat. No.: pGMLP003020
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CRYBB1/CATCN3/CTRCT17 Lentiviral expression plasmid for CRYBB1 lentivirus packaging, CRYBB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CRYBB1/CATCN3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $489.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003020
Gene Name CRYBB1
Accession Number NM_001887
Gene ID 1414
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 759 bp
Gene Alias CATCN3,CTRCT17
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTCAGGCTGCAAAGGCCTCGGCCTCGGCCACAGTGGCGGTGAACCCAGGGCCTGACACCAAGGGGAAGGGGGCCCCACCTGCAGGAACATCCCCTAGTCCCGGCACTACCCTGGCCCCAACAACCGTGCCTATTACCAGCGCCAAGGCGGCGGAACTGCCTCCTGGGAACTACAGGCTGGTGGTCTTCGAACTGGAAAACTTCCAGGGCCGTCGAGCAGAATTCTCGGGGGAGTGCTCAAATCTGGCAGACCGTGGCTTCGACCGTGTGCGCAGCATCATTGTCTCCGCGGGACCCTGGGTCGCCTTTGAGCAGTCCAACTTCCGCGGGGAGATGTTCATCCTGGAGAAGGGCGAGTACCCTCGCTGGAACACATGGTCGAGCAGCTACCGCAGTGATCGGCTCATGTCCTTCCGGCCCATCAAAATGGATGCCCAGGAGCACAAAATCTCCCTGTTTGAAGGGGCCAACTTCAAGGGCAACACCATAGAGATCCAGGGGGACGACGCACCCAGTCTCTGGGTCTACGGCTTCAGTGACCGCGTGGGCAGCGTGAAGGTCTCCAGTGGAACATGGGTTGGCTATCAGTATCCTGGCTACCGCGGGTACCAGTACCTCCTAGAGCCTGGTGACTTCCGGCACTGGAATGAGTGGGGAGCCTTCCAGCCACAGATGCAGTCCCTGCGTCGCCTGCGTGACAAGCAGTGGCACCTCGAGGGGTCCTTCCCTGTCCTGGCCACAGAGCCCCCCAAGTGA
ORF Protein Sequence MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T38622-Ab Anti-CRYBB1 monoclonal antibody
    Target Antigen GM-Tg-g-T38622-Ag CRYBB1 protein
    ORF Viral Vector pGMLP003020 Human CRYBB1 Lentivirus plasmid
    ORF Viral Vector vGMLP003020 Human CRYBB1 Lentivirus particle


    Target information

    Target ID GM-T38622
    Target Name CRYBB1
    Gene ID 1414, 12960, 715435, 25421, 101084490, 486333, 282205, 100065077
    Gene Symbol and Synonyms 3110006K12Rik,BB1CRY,CATCN3,CRYB1,CRYB11,CRYBB1,CTRCT17
    Uniprot Accession P53674
    Uniprot Entry Name CRBB1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000100122
    Target Classification Not Available

    Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta basic group member, undergoes extensive cleavage at its N-terminal extension during lens maturation. It is also a member of a gene cluster with beta-A4, beta-B2, and beta-B3. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.