Human CYB5A/CYB5/MCB5 ORF/cDNA clone-Lentivirus plasmid (NM_148923)

Cat. No.: pGMLP003025
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CYB5A/CYB5/MCB5 Lentiviral expression plasmid for CYB5A lentivirus packaging, CYB5A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CYB5A/CYB5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003025
Gene Name CYB5A
Accession Number NM_148923
Gene ID 1528
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 405 bp
Gene Alias CYB5,MCB5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGAGCAGTCGGACGAGGCCGTGAAGTACTACACCCTAGAGGAGATTCAGAAGCACAACCACAGCAAGAGCACCTGGCTGATCCTGCACCACAAGGTGTACGATTTGACCAAATTTCTGGAAGAGCATCCTGGTGGGGAAGAAGTTTTAAGGGAACAAGCTGGAGGTGACGCTACTGAGAACTTTGAGGATGTCGGGCACTCTACAGATGCCAGGGAAATGTCCAAAACATTCATCATTGGGGAGCTCCATCCAGATGACAGACCAAAGTTAAACAAGCCTCCGGAAACTCTTATCACTACTATTGATTCTAGTTCCAGTTGGTGGACCAACTGGGTGATCCCTGCCATCTCTGCAGTGGCCGTCGCCTTGATGTATCGCCTATACATGGCAGAGGACTGA
ORF Protein Sequence MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0639-Ab Anti-CYB5A monoclonal antibody
    Target Antigen GM-Tg-g-IP0639-Ag CYB5A protein
    ORF Viral Vector pGMLP003025 Human CYB5A Lentivirus plasmid
    ORF Viral Vector vGMLP003025 Human CYB5A Lentivirus particle


    Target information

    Target ID GM-IP0639
    Target Name CYB5A
    Gene ID 1528, 109672, 694723, 64001, 101098747, 119863882, 281110, 100052210
    Gene Symbol and Synonyms 0610009N12Rik,CYB5,CYB5A,LOC119863882,MCB5,METAG
    Uniprot Accession P00167
    Uniprot Entry Name CYB5_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000166347
    Target Classification Not Available

    The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.