Human TMEM208/HSPC171 ORF/cDNA clone-Lentivirus plasmid (NM_014187)

Cat. No.: pGMLP003038
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM208/HSPC171 Lentiviral expression plasmid for TMEM208 lentivirus packaging, TMEM208 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TMEM208/HSPC171 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $430.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003038
Gene Name TMEM208
Accession Number NM_014187
Gene ID 29100
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 522 bp
Gene Alias HSPC171
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCCCAAGGGCAAAGTGGGCACGAGAGGGAAGAAGCAGATATTTGAAGAGAACAGAGAGACTCTGAAGTTCTACCTGCGGATCATACTGGGGGCCAATGCCATTTACTGCCTTGTGACGTTGGTCTTCTTTTACTCATCTGCCTCATTTTGGGCCTGGTTGGCCCTGGGCTTTAGTCTGGCAGTGTATGGGGCCAGCTACCACTCTATGAGCTCGATGGCACGAGCAGCGTTCTCTGAGGATGGGGCCCTGATGGATGGTGGCATGGACCTCAACATGGAGCAGGGCATGGCAGAGCACCTTAAGGATGTGATCCTACTGACAGCCATCGTGCAGGTGCTCAGCTGCTTCTCTCTCTATGTCTGGTCCTTCTGGCTTCTGGCTCCAGGCCGGGCCCTTTACCTCCTGTGGGTGAATGTGCTGGGCCCCTGGTTCACTGCAGACAGTGGCACCCCAGCACCAGAGCACAATGAGAAACGGCAGCGCCGACAGGAGCGGCGGCAGATGAAGCGGTTATAG
ORF Protein Sequence MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2042-Ab Anti-TMEM208 monoclonal antibody
    Target Antigen GM-Tg-g-IP2042-Ag TMEM208 protein
    ORF Viral Vector pGMLP003038 Human TMEM208 Lentivirus plasmid
    ORF Viral Vector vGMLP003038 Human TMEM208 Lentivirus particle


    Target information

    Target ID GM-IP2042
    Target Name TMEM208
    Gene ID 29100, 66320, 697228, 291963, 101099167, 489761, 507222, 100053269
    Gene Symbol and Synonyms 1700006C06Rik,2610030K20Rik,hSND2,HSPC171,RGD1560953,TMEM208
    Uniprot Accession Q9BTX3
    Uniprot Entry Name TM208_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000168701
    Target Classification Not Available

    This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.