Human SMIM11A/C21orf51/FAM165B ORF/cDNA clone-Lentivirus plasmid (NM_058182)

Cat. No.: pGMLP003049
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SMIM11A/C21orf51/FAM165B Lentiviral expression plasmid for SMIM11A lentivirus packaging, SMIM11A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SMIM11A/C21orf51 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003049
Gene Name SMIM11A
Accession Number NM_058182
Gene ID 54065
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 177 bp
Gene Alias C21orf51,FAM165B,SMIM11,SMIM11B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATTGGAAGGTTCTTGAGCACGTGCCCCTGCTGCTGTATATCTTGGCAGCAAAAACATTAATTCTCTGCCTGACATTTGCTGGGGTGAAAATGTATCAAAGAAAAAGGTTGGAGGCAAAACAACAAAAACTGGAGGCTGAAAGGAAGAAGCAATCAGAGAAAAAAGATAACTGA
ORF Protein Sequence MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1762-Ab Anti-SMIM11A monoclonal antibody
    Target Antigen GM-Tg-g-IP1762-Ag SMIM11A protein
    ORF Viral Vector pGMLP003049 Human SMIM11A Lentivirus plasmid
    ORF Viral Vector vGMLP003049 Human SMIM11A Lentivirus particle


    Target information

    Target ID GM-IP1762
    Target Name SMIM11A
    Gene ID 54065, 68936, 702792, 100174909, 101086081, 100683307, 615202, 100052013
    Gene Symbol and Synonyms 1190017O12Rik,C1H21ORF51,C21orf51,FAM165B,SMIM11,SMIM11A,SMIM11B
    Uniprot Accession P58511
    Uniprot Entry Name SIM11_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000205670
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.