Human SPTSSA/C14orf147/SSSPTA ORF/cDNA clone-Lentivirus plasmid (NM_138288)
Cat. No.: pGMLP003075
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SPTSSA/C14orf147/SSSPTA Lentiviral expression plasmid for SPTSSA lentivirus packaging, SPTSSA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
SPTSSA/C14orf147 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003075 |
Gene Name | SPTSSA |
Accession Number | NM_138288 |
Gene ID | 171546 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 216 bp |
Gene Alias | C14orf147,SSSPTA |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGGGGATGGCGCTGGCGCGGGCCTGGAAGCAGATGTCCTGGTTCTACTACCAGTACCTGCTGGTCACGGCGCTCTACATGCTGGAGCCCTGGGAGCGGACGGTGTTCAATTCCATGCTGGTTTCCATTGTGGGGATGGCACTATACACAGGATACGTCTTCATGCCCCAGCACATCATGGCGATATTGCACTACTTTGAAATCGTACAATGA |
ORF Protein Sequence | MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIVQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1816-Ab | Anti-SPTSSA monoclonal antibody |
Target Antigen | GM-Tg-g-IP1816-Ag | SPTSSA protein |
ORF Viral Vector | pGMLP003075 | Human SPTSSA Lentivirus plasmid |
ORF Viral Vector | vGMLP003075 | Human SPTSSA Lentivirus particle |
Target information
Target ID | GM-IP1816 |
Target Name | SPTSSA |
Gene ID | 171546, 104725, 717580, 500651, 111560868, 119872801, 615641 |
Gene Symbol and Synonyms | 1110002B05Rik,C14orf147,C21H14orf147,C7H14orf147,SPTSSA,SSSPTA |
Uniprot Accession | Q969W0 |
Uniprot Entry Name | SPTSA_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000165389 |
Target Classification | Not Available |
Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTA is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.