Human SPTSSA/C14orf147/SSSPTA ORF/cDNA clone-Lentivirus plasmid (NM_138288)

Cat. No.: pGMLP003075
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPTSSA/C14orf147/SSSPTA Lentiviral expression plasmid for SPTSSA lentivirus packaging, SPTSSA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SPTSSA/C14orf147 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003075
Gene Name SPTSSA
Accession Number NM_138288
Gene ID 171546
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 216 bp
Gene Alias C14orf147,SSSPTA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGGGATGGCGCTGGCGCGGGCCTGGAAGCAGATGTCCTGGTTCTACTACCAGTACCTGCTGGTCACGGCGCTCTACATGCTGGAGCCCTGGGAGCGGACGGTGTTCAATTCCATGCTGGTTTCCATTGTGGGGATGGCACTATACACAGGATACGTCTTCATGCCCCAGCACATCATGGCGATATTGCACTACTTTGAAATCGTACAATGA
ORF Protein Sequence MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIVQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1816-Ab Anti-SPTSSA monoclonal antibody
    Target Antigen GM-Tg-g-IP1816-Ag SPTSSA protein
    ORF Viral Vector pGMLP003075 Human SPTSSA Lentivirus plasmid
    ORF Viral Vector vGMLP003075 Human SPTSSA Lentivirus particle


    Target information

    Target ID GM-IP1816
    Target Name SPTSSA
    Gene ID 171546, 104725, 717580, 500651, 111560868, 119872801, 615641
    Gene Symbol and Synonyms 1110002B05Rik,C14orf147,C21H14orf147,C7H14orf147,SPTSSA,SSSPTA
    Uniprot Accession Q969W0
    Uniprot Entry Name SPTSA_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000165389
    Target Classification Not Available

    Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTA is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.