Human MANBAL ORF/cDNA clone-Lentivirus plasmid (NM_022077)

Cat. No.: pGMLP003099
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MANBAL/ Lentiviral expression plasmid for MANBAL lentivirus packaging, MANBAL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MANBAL/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003099
Gene Name MANBAL
Accession Number NM_022077
Gene ID 63905
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 258 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTCTGACCTAGACTTCTCACCTCCGGAGGTGCCCGAGCCCACTTTCCTGGAGAACCTGCTACGGTACGGACTCTTCCTGGGAGCCATCTTCCAGCTCATCTGTGTGCTGGCCATCATCGTACCCATTCCCAAGTCCCACGAGGCGGAGGCTGAACCGTCTGAGCCCAGAAGTGCTGAGGTGACGAGGAAGCCCAAGGCTGCTGTTCCTTCTGTGAACAAGAGGCCCAAGAAAGAGACTAAGAAGAAGCGGTAG
ORF Protein Sequence MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1145-Ab Anti-MANBAL monoclonal antibody
    Target Antigen GM-Tg-g-IP1145-Ag MANBAL protein
    ORF Viral Vector pGMLP003099 Human MANBAL Lentivirus plasmid
    ORF Viral Vector vGMLP003099 Human MANBAL Lentivirus particle


    Target information

    Target ID GM-IP1145
    Target Name MANBAL
    Gene ID 63905, 69161, 701167, 499934, 101100800, 610351, 787482, 100055328
    Gene Symbol and Synonyms 1810024K12Rik,MANBAL
    Uniprot Accession Q9NQG1
    Uniprot Entry Name MANBL_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000101363
    Target Classification Not Available

    Predicted to be integral component of membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.