Human SCAMP4/SCAMP-4 ORF/cDNA clone-Lentivirus plasmid (NM_079834)

Cat. No.: pGMLP003101
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SCAMP4/SCAMP-4 Lentiviral expression plasmid for SCAMP4 lentivirus packaging, SCAMP4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SCAMP4/SCAMP-4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $472.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003101
Gene Name SCAMP4
Accession Number NM_079834
Gene ID 113178
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 690 bp
Gene Alias SCAMP-4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCAGAAAAGGAGAACAACTTCCCGCCACTGCCCAAGTTCATCCCTGTGAAGCCCTGCTTCTACCAGAACTTCTCCGACGAGATCCCAGTGGAGCACCAGGTCCTGGTGAAGAGGATCTACCGGCTGTGGATGTTTTACTGCGCCACCCTCGGCGTCAACCTCATTGCCTGCCTGGCCTGGTGGATCGGCGGAGGCTCGGGGACCAACTTCGGCCTGGCCTTCGTGTGGCTGCTCCTGTTCACGCCTTGCGGCTACGTGTGCTGGTTCCGGCCTGTCTACAAGGCCTTCCGAGCCGACAGCTCCTTTAATTTCATGGCGTTTTTCTTCATCTTCGGAGCCCAGTTTGTCCTGACCGTCATCCAGGCGATTGGCTTCTCCGGCTGGGGCGCGTGCGGCTGGCTGTCGGCAATTGGATTCTTCCAGTACAGCCCGGGCGCTGCCGTGGTCATGCTGCTTCCAGCCATCATGTTCTCCGTGTCGGCTGCCATGATGGCCATCGCGATCATGAAGGTGCACAGGATCTACCGAGGGGCTGGCGGAAGCTTCCAGAAGGCACAGACGGAGTGGAACACGGGCACTTGGCGGAACCCACCGTCGAGGGAGGCCCAGTACAACAACTTCTCAGGCAACAGCCTGCCCGAGTACCCCACTGTGCCCAGCTACCCGGGCAGTGGCCAGTGGCCTTAG
ORF Protein Sequence MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTNFGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1579-Ab Anti-SCAMP4 monoclonal antibody
    Target Antigen GM-Tg-g-IP1579-Ag SCAMP4 protein
    ORF Viral Vector pGMLP003101 Human SCAMP4 Lentivirus plasmid
    ORF Viral Vector vGMLP003101 Human SCAMP4 Lentivirus particle


    Target information

    Target ID GM-IP1579
    Target Name SCAMP4
    Gene ID 113178, 56214, 709219, 65170, 101099940, 612221, 100068660
    Gene Symbol and Synonyms 2410022D05Rik,Sc4,SCAMP-4,SCAMP4
    Uniprot Accession Q969E2
    Uniprot Entry Name SCAM4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000227500
    Target Classification Not Available

    Secretory carrier membrane proteins (SCAMPs) are widely distributed integral membrane proteins implicated in membrane trafficking. Most SCAMPs (e.g., SCAMP1; MIM 606911) have N-terminal cytoplasmic NPF (arg-pro-phe) repeats, 4 central transmembrane regions, and a short C-terminal cytoplasmic tail. These SCAMPs likely have a role in endocytosis that is mediated by their NPF repeats. Other SCAMPs, such as SCAMP4, lack the NPF repeats and are therefore unlikely to function in endocytosis (summary by Fernandez-Chacon and Sudhof, 2000 [PubMed 11050114]).[supplied by OMIM, Feb 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.