Human EMC6/RAB5IFL/TMEM93 ORF/cDNA clone-Lentivirus plasmid (NM_031298)

Cat. No.: pGMLP003114
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EMC6/RAB5IFL/TMEM93 Lentiviral expression plasmid for EMC6 lentivirus packaging, EMC6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to EMC6/RAB5IFL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003114
Gene Name EMC6
Accession Number NM_031298
Gene ID 83460
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 333 bp
Gene Alias RAB5IFL,TMEM93
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGCGGTGGTGGCCAAGCGGGAAGGGCCGCCGTTCATCAGCGAGGCGGCCGTGCGGGGCAACGCCGCCGTCCTGGATTATTGCCGGACCTCGGTGTCAGCGCTGTCGGGGGCCACGGCCGGCATCCTCGGCCTCACCGGCCTCTACGGCTTCATCTTCTACCTGCTCGCCTCCGTCCTGCTCTCCCTGCTCCTCATTCTCAAGGCGGGAAGGAGGTGGAACAAATATTTCAAATCACGGAGACCTCTCTTTACAGGAGGCCTCATCGGGGGCCTCTTCACCTACGTCCTGTTCTGGACGTTCCTCTACGGCATGGTGCACGTCTACTGA
ORF Protein Sequence MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0756-Ab Anti-EMC6 monoclonal antibody
    Target Antigen GM-Tg-g-IP0756-Ag EMC6 protein
    ORF Viral Vector pGMLP003114 Human EMC6 Lentivirus plasmid
    ORF Viral Vector vGMLP003114 Human EMC6 Lentivirus particle


    Target information

    Target ID GM-IP0756
    Target Name EMC6
    Gene ID 83460, 66048, 707030, 287477, 101092064, 100856142, 613551, 100060628
    Gene Symbol and Synonyms 0610009E20Rik,0610025L18Rik,EMC6,RAB5IFL,RGD1309231,TMEM93
    Uniprot Accession Q9BV81
    Uniprot Entry Name EMC6_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000127774
    Target Classification Not Available

    Contributes to membrane insertase activity. Involved in autophagosome assembly; protein insertion into ER membrane by stop-transfer membrane-anchor sequence; and tail-anchored membrane protein insertion into ER membrane. Is integral component of endoplasmic reticulum membrane and integral component of omegasome membrane. Part of EMC complex. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.