Human TSPAN18/TSPAN ORF/cDNA clone-Lentivirus plasmid (NM_130783)

Cat. No.: pGMLP003128
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TSPAN18/TSPAN Lentiviral expression plasmid for TSPAN18 lentivirus packaging, TSPAN18 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TSPAN18/TSPAN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003128
Gene Name TSPAN18
Accession Number NM_130783
Gene ID 90139
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 747 bp
Gene Alias TSPAN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGGCGACTGTCTGAGCTGCATGAAGTATCTGATGTTTGTATTCAATTTCTTCATATTTCTGGGCGGGGCCTGCCTGCTGGCCATCGGCATCTGGGTCATGGTGGACCCCACCGGCTTCCGGGAGATCGTGGCTGCCAATCCTCTGCTCCTCACGGGCGCCTACATCCTCCTGGCCATGGGGGGCCTGCTCTTTCTGCTCGGCTTCCTGGGCTGCTGCGGGGCCGTCCGTGAGAACAAGTGTCTGCTGCTATTTTTCTTCCTGTTCATCCTGATCATCTTCCTGGCAGAGCTCTCAGCAGCCATCCTGGCCTTCATCTTCAGGGAAAATCTCACCCGAGAATTCTTCACCAAGGAGCTCACCAAGCACTACCAGGGCAATAACGACACAGACGTCTTCTCTGCCACCTGGAACTCGGTCATGATCACATTTGGTTGCTGCGGGGTCAACGGGCCTGAAGACTTTAAGTTTGCATCTGTGTTTCGACTCCTGACCCTGGATAGTGAAGAGGTGCCGGAGGCCTGCTGCCGGAGGGAACCCCAAAGTCGGGACGGGGTCCTGCTGAGCCGGGAGGAGTGCCTCCTGGGAAGGAGCCTATTCCTAAACAAGCAGGGCTGTTACACGGTGATCCTCAACACCTTCGAGACCTACGTCTACTTGGCCGGAGCCCTTGCCATCGGGGTACTGGCCATCGAGCTTTTCGCCATGATCTTTGCCATGTGCCTCTTCCGGGGCATCCAGTAG
ORF Protein Sequence MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLAMGGLLFLLGFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKELTKHYQGNNDTDVFSATWNSVMITFGCCGVNGPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIELFAMIFAMCLFRGIQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2188-Ab Anti-TSPAN18 monoclonal antibody
    Target Antigen GM-Tg-g-IP2188-Ag TSPAN18 protein
    ORF Viral Vector pGMLP003128 Human TSPAN18 Lentivirus plasmid
    ORF Viral Vector vGMLP003128 Human TSPAN18 Lentivirus particle


    Target information

    Target ID GM-IP2188
    Target Name TSPAN18
    Gene ID 90139, 241556, 715506, 311210, 101084570, 611375, 783765, 100056203
    Gene Symbol and Synonyms 2610042G18Rik,6720430O15,RGD1560411,TSPAN,TSPAN18
    Uniprot Accession Q96SJ8
    Uniprot Entry Name TSN18_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000157570
    Target Classification Not Available

    Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.