Human ERMN/JN/KIAA1189 ORF/cDNA clone-Lentivirus plasmid (NM_001009959)

Cat. No.: pGMLP003133
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ERMN/JN/KIAA1189 Lentiviral expression plasmid for ERMN lentivirus packaging, ERMN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ERMN/JN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $523.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003133
Gene Name ERMN
Accession Number NM_001009959
Gene ID 57471
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 894 bp
Gene Alias JN,KIAA1189
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGACTCTCTCTCCAGATCGGATTCAACCGCACATCATGACAGATGTTCCGGCTACATTTACCCAGGCTGAGTGTAATGGGGATAAACCACCTGAAAACGGTCAACAAACAATCACTAAAATCAGTGAGGAATTGACTGATGTGGACAGCCCCCTGCCACACTACAGGGTAGAACCCAGTCTGGAAGGTGCACTCACCAAAGGAAGTCAGGAGGAAAGAAGAAAATTACAAGGGAACATGCTGCTCAACTCATCCATGGAGGACAAAATGCTAAAAGAAAACCCAGAAGAGAAACTCTTTATTGTTCATAAGGCTATCACAGATCTTTCTCTCCAAGAAACTAGTGCTGATGAAATGACATTCAGAGAAGGGCATCAGTGGGAGAAGATTCCTCTGAGTGGCAGTAACCAGGAAATAAGAAGACAGAAGGAGAGGATTACTGAGCAGCCTCTCAAAGAGGAAGAAGATGAGGACAGGAAGAACAAAGGTCACCAGGCAGCTGAAATTGAATGGCTGGGATTTCGAAAACCTAGCCAAGCTGACATGTTACATTCTAAACATGATGAGGAGCAGAAGGTTTGGGATGAAGAAATTGATGATGATGATGATGATAATTGCAATAATGATGAAGATGAAGTTCGAGTGATAGAATTTAAGAAAAAACATGAAGAGGTTTCTCAATTTAAAGAGGAAGGTGATGCAAGTGAGGACTCCCCACTGAGCAGTGCCAGTTCCCAAGCTGTGACACCTGATGAGCAGCCAACCTTAGGGAAGAAGAGTGATATCTCCAGAAATGCTTATTCCAGATACAATACAATATCCTATCGGAAAATCAGAAAGGGAAATACCAAGCAAAGAATTGATGAATTCGAGTCTATGATGCATTTATAA
ORF Protein Sequence MKTLSPDRIQPHIMTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2479-Ab Anti-ERMN monoclonal antibody
    Target Antigen GM-Tg-g-IP2479-Ag ERMN protein
    ORF Viral Vector pGMLP003133 Human ERMN Lentivirus plasmid
    ORF Viral Vector vGMLP003133 Human ERMN Lentivirus particle


    Target information

    Target ID GM-IP2479
    Target Name ERMN
    Gene ID 57471, 77767, 697560, 295619, 101095358, 607626, 617274, 100059459
    Gene Symbol and Synonyms A330104H05Rik,ermin,ERMN,JN,juxtanodin,KIAA1189,mKIAA1189,RGD1308367
    Uniprot Accession Q8TAM6
    Uniprot Entry Name ERMIN_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000136541
    Target Classification Not Available

    Predicted to enable actin filament binding activity. Involved in actin filament organization; regulation of cell projection organization; and regulation of cell shape. Located in cell cortex; internode region of axon; and paranode region of axon. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.