Human FAM177A1/C14orf24 ORF/cDNA clone-Lentivirus plasmid (NM_173607)

Cat. No.: pGMLP003203
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FAM177A1/C14orf24 Lentiviral expression plasmid for FAM177A1 lentivirus packaging, FAM177A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to FAM177A1/C14orf24 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $477.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003203
Gene Name FAM177A1
Accession Number NM_173607
Gene ID 283635
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 711 bp
Gene Alias C14orf24
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGTGGGCTTACCGGCCATTACCCTCTTTCTCACCAGCGCCAGCAGCCCTGTGGTGGCGACGACGATGGACCAGGAGCCAGTGGGCGGTGTGGAACGAGGAGAAGCCGTCGCAGCCTCGGGAGCTGCGGCCGCCGCGGCATTCGGGGAATCTGCAGGGCAGATGAGTAACGAAAGAGGCTTTGAAAATGTAGAACTGGGAGTCATAGGAAAAAAGAAGAAAGTCCCAAGGAGAGTCATCCACTTTGTTAGTGGTGAAACAATGGAAGAATATAGCACAGATGAAGACGAAGTTGATGGCCTGGAGAAGAAAGATGTTTTGCCTACTGTTGATCCGACAAAACTTACCTGGGGTCCCTACTTATGGTTTTACATGCTTCGGGCTGCTACATCAACTCTCTCAGTGTGTGACTTCCTTGGAGAGAAGATTGCATCTGTTTTGGGTATCAGCACCCCAAAGTACCAATATGCCATTGATGAATATTATCGGATGAAGAAGGAGGAAGAAGAAGAAGAAGAAGAAAACAGGATGTCTGAAGAAGCAGAAAAACAATATCAACAGAATAAATTGCAGACTGATTCCATTGTTCAGACAGATCAACCAGAGACAGTGATATCCAGCTCATTTGTGAATGTCAATTTTGAAATGGAGGGAGACAGTGAAGTAATTATGGAAAGCAAGCAAAATCCAGTCTCTGTCCCACCATAA
ORF Protein Sequence MEVGLPAITLFLTSASSPVVATTMDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYRMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVPP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0911-Ab Anti-F177A/ FAM177A1/ C14orf24 functional antibody
    Target Antigen GM-Tg-g-SE0911-Ag FAM177A1 protein
    ORF Viral Vector pGMLP003203 Human FAM177A1 Lentivirus plasmid
    ORF Viral Vector pGMAD000388 Human FAM177A1 Adenovirus plasmid
    ORF Viral Vector vGMLP003203 Human FAM177A1 Lentivirus particle
    ORF Viral Vector vGMAD000388 Human FAM177A1 Adenovirus particle


    Target information

    Target ID GM-SE0911
    Target Name FAM177A1
    Gene ID 283635, 100101807, 694483, 100359558, 101083855, 100686710, 100125286, 100050727
    Gene Symbol and Synonyms 1700047I17Rik2,C14orf24,FAM177A1,Fam177a2
    Uniprot Accession Q8N128
    Uniprot Entry Name F177A_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000151327
    Target Classification Not Available

    This gene encodes a member of a conserved protein family. Alternative splicing results in multiple transcript variants. This gene is thought to be associated with susceptibility to juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.