Human DHDDS/CIT/CPT ORF/cDNA clone-Lentivirus plasmid (NM_001243565)

Cat. No.: pGMLP003218
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DHDDS/CIT/CPT Lentiviral expression plasmid for DHDDS lentivirus packaging, DHDDS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DHDDS/CIT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $521.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003218
Gene Name DHDDS
Accession Number NM_001243565
Gene ID 79947
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 885 bp
Gene Alias CIT,CPT,DEDSM,DS,HDS,RP59
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCATGGATCAAGGAAGGAGAGCTGTCACTTTGGGAGCGGTTCTGTGCCAACATCATAAAGGCAGGCCCAATGCCGAAACACATTGCATTCATAATGGACGGGAACCGTCGCTATGCCAAGAAGTGCCAGGTGGAGCGGCAGGAAGGCCACTCACAGGGCTTCAACAAGCTAGCTGAGACTCTGCGGTGGTGTTTGAACCTGGGCATCCTAGAGGTGACAGTCTACGCATTCAGCATTGAGAACTTCAAACGCTCCAAGAGTGAGGTAGACGGGCTTATGGATCTGGCCCGGCAGAAGTTCAGCCGCTTGATGGAAGAAAAGTGTTTCCTGAATGTCTGTTTTGCATACACATCCCGTCATGAGATCAGCAATGCTGTGAGAGAGATGGCCTGGGGGGTGGAGCAAGGCCTGTTGGATCCCAGTGATATCTCTGAGTCTCTGCTTGATAAGTGCCTCTATACCAACCGCTCTCCTCATCCTGACATCTTGATACGGACTTCTGGAGAAGTGCGGCTGAGTGACTTCTTGCTATGGCAGACCTCTCACTCCTGCCTGGTGTTCCAACCCGTTCTGTGGCCAGAGTATACATTTTGGAACCTCTTCGAGGCCATCCTGCAGTTCCAGATGAACCATAGCGTGCTTCAGAAGGCCCGAGACATGTATGCAGAGGAGCGGAAGAGGCAGCAGCTGGAGAGGGACCAGGCTACAGTGACAGAGCAGCTGCTGCGAGAGGGGCTCCAAGCCAGTGGGGACGCCCAGCTCCGAAGGACACGCTTGCACAAACTCTCGGCCAGACGGGAAGAGCGAGTCCAAGGCTTCCTGCAGGCCTTGGAACTCAAGCGAGCTGACTGGCTGGCCCGTCTGGGCACTGCATCAGCCTGA
ORF Protein Sequence MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2454-Ab Anti-DHDDS monoclonal antibody
    Target Antigen GM-Tg-g-IP2454-Ag DHDDS protein
    ORF Viral Vector pGMLP003218 Human DHDDS Lentivirus plasmid
    ORF Viral Vector vGMLP003218 Human DHDDS Lentivirus particle


    Target information

    Target ID GM-IP2454
    Target Name DHDDS
    Gene ID 79947, 67422, 714635, 298541, 101085905, 612157, 523264, 100057242
    Gene Symbol and Synonyms 3222401G21Rik,cis-IPTase,CIT,CPT,DEDSM,DHDDS,DS,hCIT,HDS,RP59
    Uniprot Accession Q86SQ9
    Uniprot Entry Name DHDDS_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000117682
    Target Classification Not Available

    The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.