Human RPE/RPE2-1 ORF/cDNA clone-Lentivirus plasmid (NM_199229)

Cat. No.: pGMLP003257
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RPE/RPE2-1 Lentiviral expression plasmid for RPE lentivirus packaging, RPE lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RPE/RPE2-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $471.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003257
Gene Name RPE
Accession Number NM_199229
Gene ID 6120
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 687 bp
Gene Alias RPE2-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTCGGGCTGCAAGATTGGCCCGTCCATCCTCAACAGCGACCTGGCCAATTTAGGGGCCGAGTGCCTCCGGATGCTAGACTCTGGGGCCGATTATCTGCACCTGGACGTAATGGACGGGCATTTTGTTCCCAACATCACCTTTGGTCACCCTGTGGTAGAAAGCCTTCGAAAGCAGCTAGGCCAGGACCCTTTCTTTGACATGCACATGATGGTGTCCAAGCCAGAACAGTGGGTAAAGCCAATGGCTGTAGCAGGAGCCAATCAGTACACCTTTCATCTCGAGGCTACTGAGAACCCAGGGGCTTTGATTAAAGACATTCGGGAGAATGGGATGAAGGTTGGCCTTGCCATCAAACCAGGAACCTCAGTTGAGTATTTGGCACCATGGGCTAATCAGATAGATATGGCCTTGGTTATGACAGTGGAACCGGGGTTTGGAGGGCAGAAATTCATGGAAGATATGATGCCAAAGGTTCACTGGTTGAGGACCCAGTTCCCATCTTTGGATATAGAGGTCGATGGTGGAGTAGGTCCTGACACTGTCCATAAATGTGCAGAGGCAGGAGCTAACATGATTGTGTCTGGCAGTGCTATTATGAGGAGTGAAGACCCCAGATCTGTGATCAATCTATTAAGAAATGTTTGCTCAGAAGCTGCTCAGAAACGTTCTCTTGATCGGTGA
ORF Protein Sequence MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2713-Ab Anti-RPE monoclonal antibody
    Target Antigen GM-Tg-g-IP2713-Ag RPE protein
    ORF Viral Vector pGMLP003257 Human RPE Lentivirus plasmid
    ORF Viral Vector vGMLP003257 Human RPE Lentivirus particle


    Target information

    Target ID GM-IP2713
    Target Name RPE
    Gene ID 6120, 66646, 711322, 501157, 101095761, 478893, 533764, 100051899
    Gene Symbol and Synonyms 2810429B02Rik,5730518J08Rik,RPE,RPE2,RPE2-1
    Uniprot Accession Q96AT9
    Uniprot Entry Name RPE_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000197713
    Target Classification Not Available

    Enables metal ion binding activity; protein homodimerization activity; and ribulose-phosphate 3-epimerase activity. Involved in carbohydrate metabolic process and pentose-phosphate shunt. Located in extracellular exosome. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.