Human ZDHHC3/DHHC-3/DHHC3 ORF/cDNA clone-Lentivirus plasmid (NM_001349380)

Cat. No.: pGMLP003353
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ZDHHC3/DHHC-3/DHHC3 Lentiviral expression plasmid for ZDHHC3 lentivirus packaging, ZDHHC3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ZDHHC3/DHHC-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $525
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003353
Gene Name ZDHHC3
Accession Number NM_001349380
Gene ID 51304
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 900 bp
Gene Alias DHHC-3,DHHC3,GODZ,ZNF373
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGCTTATCCCCACCCACCACTTCCGAAACATTGAGCGGAAACCAGAATACCTCCAGCCAGAGAAGTGTGTCCCACCCCCCTACCCTGGTCCTGTGGGAACCATGTGGTTTATCCGTGACGGCTGTGGCATCGCCTGTGCCATCGTTACCTGGTTTCTGGTCCTCTATGCGGAGTTCGTGGTCCTCTTTGTCATGCTGATTCCATCTCGAGACTACGTGTATAGCATCATCAACGGAATTGTGTTCAACCTGCTGGCCTTCTTGGCCCTGGCCTCCCACTGCCGGGCCATGCTGACGGACCCCGGGGCAGTGCCCAAAGGAAATGCCACTAAAGAATTCATCGAGAGTTTACAGTTGAAGCCTGGGCAGGTGGTGTACAAGTGCCCCAAATGCTGCAGCATCAAGCCCGACCGAGCCCACCACTGCAGTGTTTGTAAGCGGTGCATTCGGAAGATGGACCACCACTGTCCCTGGGTCAACAACTGTGTAGGCGAGAACAACCAGAAGTACTTCGTCCTGTTTACAATGTACATAGCTCTCATTTCCTTGCACGCCCTCATCATGGTGGGATTCCACTTCCTGCATTGCTTTGAAGAAGATTGGACAAAGTGCAGCTCCTTCTCTCCACCCACCACAGTGATTCTCCTTATCCTGCTGTGCTTTGAGGGCCTGCTCTTCCTCATTTTCACATCAGTGATGTTTGGGACCCAGGTGCACTCCATCTGCACAGATGAGACGGGAATAGAACAATTGAAAAAGGAAGAGAGAAGATGGGCTAAAAAAACAAAATGGATGAACATGAAAGCCGTTTTTGGCCACCCCTTCTCTCTAGGCTGGGCCAGCCCCTTTGCCACGCCAGACCAAGGGAAGGCAGACCCGTACCAGTATGTGGTCTGA
ORF Protein Sequence MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2309-Ab Anti-ZDHHC3 monoclonal antibody
    Target Antigen GM-Tg-g-IP2309-Ag ZDHHC3 protein
    ORF Viral Vector pGMLP003353 Human ZDHHC3 Lentivirus plasmid
    ORF Viral Vector pGMPC004839 Human ZDHHC3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003353 Human ZDHHC3 Lentivirus particle


    Target information

    Target ID GM-IP2309
    Target Name ZDHHC3
    Gene ID 51304, 69035, 714442, 301081, 101081449, 476655, 506728, 100054643
    Gene Symbol and Synonyms 1110020O22Rik,1810006O10Rik,2210017C02Rik,DHHC-3,DHHC3,GODZ,Gramp1,ZDHHC3,Zfp373,ZNF373
    Uniprot Accession Q9NYG2
    Uniprot Entry Name ZDHC3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000163812
    Target Classification Not Available

    Enables palmitoyltransferase activity. Involved in several processes, including TRAIL-activated apoptotic signaling pathway; protein localization to membrane; and protein localization to photoreceptor outer segment. Located in Golgi apparatus. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.