Human NPS/NPS ORF/cDNA clone-Lentivirus plasmid (NM_001030013)

Cat. No.: pGMLP003373
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NPS/NPS Lentiviral expression plasmid for NPS lentivirus packaging, NPS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NPS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003373
Gene Name NPS
Accession Number NM_001030013
Gene ID 594857
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 270 bp
Gene Alias NPS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATTAGCTCAGTAAAACTCAATCTCATCCTAGTTCTGTCGCTGTCCACAATGCATGTGTTTTGGTGTTATCCAGTTCCATCTTCTAAGGTGTCTGGAAAATCTGATTACTTTCTCATTCTGCTGAACAGCTGCCCAACCAGATTGGACAGGAGCAAAGAACTAGCTTTTCTAAAGCCAATTTTGGAGAAGATGTTTGTGAAAAGGTCCTTTCGCAATGGAGTTGGCACAGGGATGAAAAAAACTTCCTTTCAAAGAGCAAAATCATGA
ORF Protein Sequence MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1135-Ab Anti-NPS functional antibody
    Target Antigen GM-Tg-g-SE1135-Ag NPS protein
    ORF Viral Vector pGMLP003373 Human NPS Lentivirus plasmid
    ORF Viral Vector vGMLP003373 Human NPS Lentivirus particle


    Target information

    Target ID GM-SE1135
    Target Name NPS
    Gene ID 594857, 100043254, 100423956, 100360071, 109492896, 111092983, 104976005, 111769619
    Gene Symbol and Synonyms NPS
    Uniprot Accession P0C0P6
    Uniprot Entry Name NPS_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000214285
    Target Classification Not Available

    Predicted to be involved in positive regulation of GABAergic synaptic transmission; positive regulation of action potential; and positive regulation of glutamatergic synaptic transmission. Predicted to act upstream of or within visual learning. Predicted to be located in extracellular region. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.