Human TMEM216/HSPC244 ORF/cDNA clone-Lentivirus plasmid (NM_001173990)

Cat. No.: pGMLP003404
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM216/HSPC244 Lentiviral expression plasmid for TMEM216 lentivirus packaging, TMEM216 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TMEM216/HSPC244 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003404
Gene Name TMEM216
Accession Number NM_001173990
Gene ID 51259
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 438 bp
Gene Alias HSPC244
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCCACGGGGACTGAAGATGGCGCCGCGAGGTAAACGGTTGTCCTCCACCCCGCTGGAAATCCTGTTCTTTCTGAACGGGTGGTATAATGCTACCTATTTCCTGCTGGAACTTTTCATATTTCTGTATAAAGGTGTCCTGCTACCATATCCAACAGCTAACCTAGTACTGGATGTGGTGATGCTCCTCCTTTATCTTGGAATTGAAGTAATTCGCCTGTTTTTTGGTACAAAGGGAAACCTCTGCCAGCGAAAGATGCCGCTCAGTATTAGCGTGGCCTTGACCTTCCCATCTGCCATGATGGCCTCCTATTACCTGCTGCTGCAGACCTACGTACTCCGCCTGGAAGCCATCATGAATGGCATCTTGCTCTTCTTCTGTGGCTCAGAGCTTTTACTTGAGGTGCTCACCTTGGCTGCTTTCTCCAGGATTTGA
ORF Protein Sequence MLPRGLKMAPRGKRLSSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFCGSELLLEVLTLAAFSRI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2050-Ab Anti-TMEM216 monoclonal antibody
    Target Antigen GM-Tg-g-IP2050-Ag TMEM216 protein
    ORF Viral Vector pGMLP003404 Human TMEM216 Lentivirus plasmid
    ORF Viral Vector vGMLP003404 Human TMEM216 Lentivirus particle


    Target information

    Target ID GM-IP2050
    Target Name TMEM216
    Gene ID 51259, 68642, 693655, 361727, 101081832, 100688144, 508031, 100629684
    Gene Symbol and Synonyms 1110017C22Rik,2810441K11Rik,4921533J23Rik,A930021F15Rik,HSPC244,RGD1304607,TMEM216
    Uniprot Accession Q9P0N5
    Uniprot Entry Name TM216_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000187049
    Target Classification Not Available

    This locus encodes a transmembrane domain-containing protein. Mutations at this locus have been associated with Meckel-Gruber Syndrome Type 2, and Joubert Syndrome 2, also known as Cerebello-oculorenal Syndrome 2. [provided by RefSeq, Aug 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.