Human IER3/DIF-2/DIF2 ORF/cDNA clone-Lentivirus plasmid (NM_003897)

Cat. No.: pGMLP003411
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IER3/DIF-2/DIF2 Lentiviral expression plasmid for IER3 lentivirus packaging, IER3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IER3/DIF-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003411
Gene Name IER3
Accession Number NM_003897
Gene ID 8870
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 471 bp
Gene Alias DIF-2,DIF2,GLY96,IEX-1,IEX-1L,IEX1,PRG1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGTCACTCTCGCAGCTGCCACCCGACCATGACCATCCTGCAGGCCCCGACCCCGGCCCCCTCCACCATCCCGGGACCCCGGCGGGGCTCCGGTCCTGAGATCTTCACCTTCGACCCTCTCCCGGAGCCCGCAGCGGCCCCTGCCGGGCGCCCCAGCGCCTCTCGCGGGCACCGAAAGCGCAGCCGCAGGGTTCTCTACCCTCGAGTGGTCCGGCGCCAGCTGCCAGTCGAGGAACCGAACCCAGCCAAAAGGCTTCTCTTTCTGCTGCTCACCATCGTCTTCTGCCAGATCCTGATGGCTGAAGAGGGTGTGCCGGCGCCCCTGCCTCCAGAGGACGCCCCTAACGCCGCATCCCTGGCGCCCACCCCTGTGTCCGCCGTCCTCGAGCCCTTTAATCTGACTTCGGAGCCCTCGGACTACGCTCTGGACCTCAGCACTTTCCTCCAGCAACACCCGGCCGCCTTCTAA
ORF Protein Sequence MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0995-Ab Anti-IER3 monoclonal antibody
    Target Antigen GM-Tg-g-IP0995-Ag IER3 protein
    ORF Viral Vector pGMLP003411 Human IER3 Lentivirus plasmid
    ORF Viral Vector vGMLP003411 Human IER3 Lentivirus particle


    Target information

    Target ID GM-IP0995
    Target Name IER3
    Gene ID 8870, 15937, 701939, 294235, 101096476, 481708, 505455, 100055430
    Gene Symbol and Synonyms cI-3,DIF-2,DIF2,GLY96,IER3,IEX-1,IEX-1L,IEX1,Ler3,PRG1
    Uniprot Accession P46695
    Uniprot Entry Name IEX1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000137331
    Target Classification Not Available

    This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not generate a valid protein. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.