Human ANXA2R/AX2R/AXIIR ORF/cDNA clone-Lentivirus plasmid (NM_001014279)

Cat. No.: pGMLP003433
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ANXA2R/AX2R/AXIIR Lentiviral expression plasmid for ANXA2R lentivirus packaging, ANXA2R lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ANXA2R/AX2R products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $445.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003433
Gene Name ANXA2R
Accession Number NM_001014279
Gene ID 389289
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 582 bp
Gene Alias AX2R,AXIIR,C5orf39
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCAACATTTTCTTGGCTGTGTGAAGCGGGCTTGGGATTCCGCAGAGGTGGCGCCAGAGCCCCAGCCTCCACCTATTGTGAGTTCAGAAGATCGTGGGCCGTGGCCTCTTCCTTTGTATCCAGTACTAGGAGAGTACTCACTGGACAGCTGTGATTTGGGACTGCTTTCCAGCCCTTGCTGGCGGCTGCCCGGAGTCTACTGGCAAAACGGACTCTCTCCTGGAGTCCAGAGCACCTTGGAACCAAGTACAGCGAAGCCCACTGAGTTCAGTTGGCCGGGGACACAGAAGCAGCAAGAGGCACCCGTAGAAGAGGTGGGGCAGGCAGAGGAACCCGACAGACTCAGGCTCCAGCAGCTTCCCTGGAGCAGTCCTCTCCATCCCTGGGACAGACAGCAGGACACCGAGGTCTGTGACAGCGGGTGCCTTTTGGAACGCCGCCATCCTCCTGCCCTCCAGCCGTGGCGCCACCTCCCGGGTTTCTCAGACTGCCTGGAGTGGATTCTTCGCGTTGGTTTTGCCGCGTTCTCTGTACTCTGGGCGTGCTGTTCACGGATCTGTGGAGCTAAGCAGCCTTAG
ORF Protein Sequence MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T80966-Ab Anti-ANXA2R monoclonal antibody
    Target Antigen GM-Tg-g-T80966-Ag ANXA2R protein
    ORF Viral Vector pGMLP003433 Human ANXA2R Lentivirus plasmid
    ORF Viral Vector vGMLP003433 Human ANXA2R Lentivirus particle


    Target information

    Target ID GM-T80966
    Target Name ANXA2R
    Gene ID 389289, 102150455
    Gene Symbol and Synonyms ANXA2R,AX2R,AXIIR,C5orf39
    Uniprot Accession Q3ZCQ2
    Uniprot Entry Name AX2R_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000177721
    Target Classification Not Available

    Predicted to enable signaling receptor activity. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.