Human REEP1/C2orf23/HMN5B ORF/cDNA clone-Lentivirus plasmid (NM_001164730)

Cat. No.: pGMLP003450
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human REEP1/C2orf23/HMN5B Lentiviral expression plasmid for REEP1 lentivirus packaging, REEP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to REEP1/C2orf23 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $456.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003450
Gene Name REEP1
Accession Number NM_001164730
Gene ID 65055
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 627 bp
Gene Alias C2orf23,HMN5B,SPG31,Yip2a
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGAAAGTGCTGAGCAACGGACAGACTGAAGAGGTTAGGTCTGGATCCAGGCTTATATTTGGCACCCTTTACCCTGCGTATTATTCCTACAAGGCTGTGAAATCAAAGGACATTAAGGAATATGTCAAATGGATGATGTACTGGATTATATTTGCACTTTTCACCACAGCAGAGACATTCACAGACATCTTCCTTTGTTGGTTTCCATTCTATTATGAACTAAAAATAGCATTTGTAGCCTGGCTGCTGTCTCCCTACACAAAAGGCTCCAGCCTCCTGTACAGGAAGTTTGTACATCCCACGCTATCTTCAAAAGAAAAGGAAATCGATGATTGTCTGGTCCAAGCAAAAGACCGAAGTTACGATGCCCTTGTGCACTTCGGGAAGCGGGGCTTGAACGTGGCCGCCACAGCGGCTGTGATGGCTGCTTCCAAGGGACAGGGTGCCTTATCGGAGAGACTGCGGAGCTTCAGCATGCAGGACCTCACCACCATCAGGGGAGACGGCGCCCCTGCTCCCTCGGGCCCCCCACCACCGGGGTCTGGGCGGGCCAGCGGCAAACACGGCCAGCCTAAGATGTCCAGGAGTGCTTCTGAGAGCGCTAGCAGCTCAGGCACCGCCTAG
ORF Protein Sequence MQKVLSNGQTEEVRSGSRLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1478-Ab Anti-REEP1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1478-Ag REEP1 protein
    ORF Viral Vector pGMLP003450 Human REEP1 Lentivirus plasmid
    ORF Viral Vector vGMLP003450 Human REEP1 Lentivirus particle


    Target information

    Target ID GM-IP1478
    Target Name REEP1
    Gene ID 65055, 52250, 697390, 362384, 101092349, 613003, 616916, 100066980
    Gene Symbol and Synonyms C2orf23,D6Ertd253e,DSMA6,HMN5B,REEP1,RGD1305230,SPG31,Yip2a
    Uniprot Accession Q9H902
    Uniprot Entry Name REEP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000068615
    Target Classification Not Available

    This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.