Human MPDU1/CDGIF/HBEBP2BPA ORF/cDNA clone-Lentivirus plasmid (NM_004870)

Cat. No.: pGMLP003484
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MPDU1/CDGIF/HBEBP2BPA Lentiviral expression plasmid for MPDU1 lentivirus packaging, MPDU1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MPDU1/CDGIF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003484
Gene Name MPDU1
Accession Number NM_004870
Gene ID 9526
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 744 bp
Gene Alias CDGIF,HBEBP2BPA,Lec35,My008,PP3958,PQLC5,SL15
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCCGAGGCGGACGGACCGCTTAAACGGCTGCTCGTGCCGATTCTTTTACCTGAGAAATGCTACGACCAACTTTTCGTTCAGTGGGACTTGCTTCACGTCCCCTGCCTCAAGATTCTCCTCAGCAAAGGCCTGGGGCTGGGCATTGTGGCTGGCTCACTTCTAGTAAAGCTGCCCCAGGTGTTTAAAATCCTGGGAGCCAAGAGTGCTGAAGGGTTGAGTCTCCAGTCTGTAATGCTGGAGCTAGTGGCATTGACTGGGACCATGGTCTACAGCATCACTAACAACTTCCCATTCAGCTCTTGGGGTGAAGCCTTATTCCTGATGCTCCAGACGATCACCATCTGCTTCCTGGTCATGCACTACAGAGGACAGACTGTGAAAGGTGTCGCTTTCCTCGCTTGCTACGGCCTGGTCCTGCTGGTGCTTCTCTCACCTCTGACGCCCTTGACTGTAGTCACCCTGCTCCAGGCCTCCAATGTGCCTGCTGTGGTGGTGGGGAGGCTTCTCCAGGCAGCCACCAACTACCACAACGGGCACACAGGCCAGCTCTCAGCCATCACAGTCTTCCTGCTGTTTGGGGGCTCCCTGGCCCGAATCTTCACTTCCATTCAGGAAACCGGAGATCCCCTGATGGCTGGGACCTTTGTGGTCTCCTCTCTCTGCAACGGCCTCATCGCCGCCCAGCTGCTCTTCTACTGGAATGCAAAGCCTCCCCACAAGCAGAAAAAGGCGCAGTAG
ORF Protein Sequence MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNGHTGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1205-Ab Anti-MPDU1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1205-Ag MPDU1 protein
    ORF Viral Vector pGMLP003484 Human MPDU1 Lentivirus plasmid
    ORF Viral Vector vGMLP003484 Human MPDU1 Lentivirus particle


    Target information

    Target ID GM-IP1205
    Target Name MPDU1
    Gene ID 9526, 24070, 715962, 303244, 101098754, 489477, 504961, 100062007
    Gene Symbol and Synonyms CDGIF,HBEBP2BPA,Lec35,MPDU1,My008,PP3958,PQLC5,SL15,SLC66A5,Supl15h
    Uniprot Accession O75352
    Uniprot Entry Name MPU1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000129255
    Target Classification Not Available

    This gene encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.