Human TMEM70/MC5DN2 ORF/cDNA clone-Lentivirus plasmid (NM_017866)

Cat. No.: pGMLP003487
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM70/MC5DN2 Lentiviral expression plasmid for TMEM70 lentivirus packaging, TMEM70 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMEM70/MC5DN2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $495.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003487
Gene Name TMEM70
Accession Number NM_017866
Gene ID 54968
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 783 bp
Gene Alias MC5DN2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGTTTCTGGCGTTGGGCAGCCCGTGGGCGGTCGAACTGCCTCTCTGCGGAAGGAGGACTGCATTGTGTGCGGCCGCCGCGCTCCGAGGTCCCCGGGCCTCTGTCTCCCGGGCGTCCTCCAGCAGCGGGCCTTCGGGGCCGGTAGCCGGCTGGAGTACGGGGCCTTCGGGAGCCGCGCGCCTTCTCCGGCGTCCGGGTCGAGCGCAGATCCCTGTTTATTGGGAAGGATATGTTCGATTCTTAAATACGCCATCTGACAAATCAGAAGATGGAAGGCTAATTTATACTGGCAATATGGCCCGAGCAGTGTTTGGTGTGAAATGTTTCTCTTATTCTACGAGTCTGATTGGCCTTACATTTCTGCCATACATTTTTACACAAAATAATGCTATTTCTGAAAGTGTGCCTCTGCCTATTCAAATCATATTCTATGGCATCATGGGAAGCTTTACGGTGATCACCCCAGTGCTGCTTCACTTTATTACAAAAGGCTATGTCATTCGATTGTACCATGAGGCCACAACAGACACTTATAAAGCCATTACCTACAATGCTATGCTTGCAGAAACGAGTACAGTGTTTCACCAGAATGATGTGAAGATTCCAGATGCTAAACATGTATTTACCACATTTTATGCTAAAACAAAATCACTGTTAGTTAATCCAGTGCTCTTTCCAAACCGTGAAGACTATATCCATCTAATGGGTTATGACAAAGAAGAATTTATTTTGTATATGGAAGAAACCAGTGAAGAGAAACGGCATAAAGATGACAAATGA
ORF Protein Sequence MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2123-Ab Anti-TMEM70 monoclonal antibody
    Target Antigen GM-Tg-g-IP2123-Ag TMEM70 protein
    ORF Viral Vector pGMLP003487 Human TMEM70 Lentivirus plasmid
    ORF Viral Vector vGMLP003487 Human TMEM70 Lentivirus particle


    Target information

    Target ID GM-IP2123
    Target Name TMEM70
    Gene ID 54968, 70397, 696532, 500384, 101100616, 477915, 613774, 100146309
    Gene Symbol and Synonyms 1110020A09Rik,2210416J16Rik,MC5DN2,RGD1566224,TMEM70
    Uniprot Accession Q9BUB7
    Uniprot Entry Name TMM70_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000175606
    Target Classification Not Available

    This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.