Human TMEM70/MC5DN2 ORF/cDNA clone-Lentivirus plasmid (NM_017866)
Cat. No.: pGMLP003487
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TMEM70/MC5DN2 Lentiviral expression plasmid for TMEM70 lentivirus packaging, TMEM70 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TMEM70/MC5DN2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP003487 |
Gene Name | TMEM70 |
Accession Number | NM_017866 |
Gene ID | 54968 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 783 bp |
Gene Alias | MC5DN2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTGTTTCTGGCGTTGGGCAGCCCGTGGGCGGTCGAACTGCCTCTCTGCGGAAGGAGGACTGCATTGTGTGCGGCCGCCGCGCTCCGAGGTCCCCGGGCCTCTGTCTCCCGGGCGTCCTCCAGCAGCGGGCCTTCGGGGCCGGTAGCCGGCTGGAGTACGGGGCCTTCGGGAGCCGCGCGCCTTCTCCGGCGTCCGGGTCGAGCGCAGATCCCTGTTTATTGGGAAGGATATGTTCGATTCTTAAATACGCCATCTGACAAATCAGAAGATGGAAGGCTAATTTATACTGGCAATATGGCCCGAGCAGTGTTTGGTGTGAAATGTTTCTCTTATTCTACGAGTCTGATTGGCCTTACATTTCTGCCATACATTTTTACACAAAATAATGCTATTTCTGAAAGTGTGCCTCTGCCTATTCAAATCATATTCTATGGCATCATGGGAAGCTTTACGGTGATCACCCCAGTGCTGCTTCACTTTATTACAAAAGGCTATGTCATTCGATTGTACCATGAGGCCACAACAGACACTTATAAAGCCATTACCTACAATGCTATGCTTGCAGAAACGAGTACAGTGTTTCACCAGAATGATGTGAAGATTCCAGATGCTAAACATGTATTTACCACATTTTATGCTAAAACAAAATCACTGTTAGTTAATCCAGTGCTCTTTCCAAACCGTGAAGACTATATCCATCTAATGGGTTATGACAAAGAAGAATTTATTTTGTATATGGAAGAAACCAGTGAAGAGAAACGGCATAAAGATGACAAATGA |
ORF Protein Sequence | MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2123-Ab | Anti-TMEM70 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2123-Ag | TMEM70 protein |
ORF Viral Vector | pGMLP003487 | Human TMEM70 Lentivirus plasmid |
ORF Viral Vector | vGMLP003487 | Human TMEM70 Lentivirus particle |
Target information
Target ID | GM-IP2123 |
Target Name | TMEM70 |
Gene ID | 54968, 70397, 696532, 500384, 101100616, 477915, 613774, 100146309 |
Gene Symbol and Synonyms | 1110020A09Rik,2210416J16Rik,MC5DN2,RGD1566224,TMEM70 |
Uniprot Accession | Q9BUB7 |
Uniprot Entry Name | TMM70_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000175606 |
Target Classification | Not Available |
This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.