Human CCDC28A/C6orf80/CCRL1AP ORF/cDNA clone-Lentivirus plasmid (NM_015439)

Cat. No.: pGMLP003498
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCDC28A/C6orf80/CCRL1AP Lentiviral expression plasmid for CCDC28A lentivirus packaging, CCDC28A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCDC28A/C6orf80 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $506.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003498
Gene Name CCDC28A
Accession Number NM_015439
Gene ID 25901
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 825 bp
Gene Alias C6orf80,CCRL1AP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGAGCGGAAAGTGAAGAGGAGGAGTCCTAAGTCTTTTAGTGCCCACTGTACTCAGGTTGTCAATGCCAAAAAAAATGCCATTCCAGTGAGTAAAAGCACAGGGTTTTCAAATCCTGCATCACAGTCAACTTCACAGCGACCAAAGTTAAAAAGAGTGATGAAAGAAAAGACCAAACCTCAGGGTGGAGAGGGCAAAGGCGCTCAGTCAACTCCGATCCAGCACTCCTTCCTCACTGATGTCTCAGATGTTCAGGAGATGGAGAGAGGGCTGCTCAGTCTTTTGAATGATTTCCACTCTGGAAAACTTCAAGCATTTGGAAATGAATGTTCCATTGAACAGATGGAACATGTTCGGGGAATGCAGGAGAAATTAGCTCGCTTGAATTTGGAGCTCTATGGGGAGTTAGAGGAACTTCCTGAGGATAAGAGAAAAACAGCCAGTGACTCCAATCTGGATAGGCTTCTGTCAGATTTAGAAGAATTGAATTCTTCCATACAAAAACTCCATTTGGCAGATGCACAAGATGTTCCAAATACTTCTGCTAGCTAA
ORF Protein Sequence MEERKVKRRSPKSFSAHCTQVVNAKKNAIPVSKSTGFSNPASQSTSQRPKLKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2410-Ab Anti-CCDC28A monoclonal antibody
    Target Antigen GM-Tg-g-IP2410-Ag CCDC28A protein
    ORF Viral Vector pGMLP003498 Human CCDC28A Lentivirus plasmid
    ORF Viral Vector vGMLP003498 Human CCDC28A Lentivirus particle


    Target information

    Target ID GM-IP2410
    Target Name CCDC28A
    Gene ID 25901, 215814, 703104, 361454, 101088334, 476220, 532940, 100067862
    Gene Symbol and Synonyms 1700009P13Rik,C6orf80,CCDC28A,CCRL1AP,RGD1310326
    Uniprot Accession Q8IWP9
    Uniprot Entry Name CC28A_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000024862
    Target Classification Not Available

    This gene encodes a coiled-coil domain containing protein. Although the specific function of this gene has not yet been determined, this gene is a known translocation partner of nucleoporin 98 in acute leukemias. The resulting fusion gene produces a nucleoporin 98-coiled-coil domain-containing protein 28A chimeric protein which may be involved in promoting myeloproliferative neoplasms. [provided by RefSeq, Jan 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.