Human TOMM7/TOM7 ORF/cDNA clone-Lentivirus plasmid (NM_019059)

Cat. No.: pGMLP003832
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TOMM7/TOM7 Lentiviral expression plasmid for TOMM7 lentivirus packaging, TOMM7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TOMM7/TOM7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003832
Gene Name TOMM7
Accession Number NM_019059
Gene ID 54543
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 168 bp
Gene Alias TOM7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGAAGCTGAGCAAAGAGGCCAAGCAGAGACTACAGCAGCTCTTCAAGGGGAGCCAGTTTGCCATTCGCTGGGGCTTTATCCCTCTTGTGATTTACCTGGGATTTAAGAGGGGTGCAGATCCCGGAATGCCTGAACCAACTGTTTTGAGCCTACTTTGGGGATAA
ORF Protein Sequence MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2162-Ab Anti-TOMM7 monoclonal antibody
    Target Antigen GM-Tg-g-IP2162-Ag TOMM7 protein
    ORF Viral Vector pGMLP003832 Human TOMM7 Lentivirus plasmid
    ORF Viral Vector vGMLP003832 Human TOMM7 Lentivirus particle


    Target information

    Target ID GM-IP2162
    Target Name TOMM7
    Gene ID 54543, 66169, 705701, 685620, 102899863, 482351, 614074, 100630688
    Gene Symbol and Synonyms 1110020J08Rik,TOM7,TOMM7
    Uniprot Accession Q9P0U1
    Uniprot Entry Name TOM7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000196683
    Target Classification Not Available

    This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex. [provided by RefSeq, Oct 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.