Human NMI ORF/cDNA clone-Lentivirus plasmid (BC021987)

Cat. No.: pGMLP003879
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NMI/ Lentiviral expression plasmid for NMI lentivirus packaging, NMI lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NMI/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $531
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003879
Gene Name NMI
Accession Number BC021987
Gene ID 9111
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 924 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGCTGATAAAGATGACACACAACAAATTCTTAAGGAGCATTCGCCAGATGAATTTATAAAAGATGAACAAAATAAGGGACTAATTGATGAAATTACAAAGAAAAATATTCAGCTAAGGAAGGAGATCCAAAAGCTTGAAACGGAGTTACAAGAGGCTACCAAAGAATTCCAGATTAAAGAGGATATTCCTGAAACAAAGATGAAATTCTTATCAGTTGAAACTCCTGAGAATGACAGCCAGTTGTCAAATATCTCCTGTTCGTTTCAAGTGAGCTCGAAAGTTCCTTATGAGATACAAAAAGGACAAGCACTTATCACCTTTGAAAAAGAAGAAGTTGCTCAAAATGTGGTAAGCATGAGTAAACATCATGTACAGATAAAAGATGTAAATCTGGAGGTTACGGCCAAGCCAGTTCCATTAAATTCAGGAGTCAGATTCCAGGTTTATGTAGAAGTTTCTAAAATGAAAATCAATGTTACTGAAATTCCTGACACACTGCGTGAAGATCAAATGAGAGACAAACTAGAGCTGAGCTTTTCAAAGTCCCGAAATGGAGGCGGAGAGGTGGACCGCGTGGACTATGACAGACAGTCCGGGAGTGCAGTCATCACGTTTGTGGAGATTGGAGTGGCTGACAAGATTTTGAAAAAGAAAGAATACCCTCTTTATATAAATCAAACTTGCCATAGAGTTACTGTTTCTCCATACACAGAAATACACTTGAAAAAGTATCAGATATTTTCAGGAACATCTAAGAGGACAGTGCTTCTGACAGGAATGGAAGGCATTCAAATGGATGAAGAAATTGTGGAGGATTTAATTAACATTCACTTTCAACGGGCAAAGAATGGAGGTGGAGAAGTAGATGTGGTCAAGTGTTCTCTAGGTCAACCTCACATAGCATACTTTGAAGAATAG
ORF Protein Sequence MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLRKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1126-Ab Anti-NMI functional antibody
    Target Antigen GM-Tg-g-SE1126-Ag NMI protein
    ORF Viral Vector pGMLP001279 Human NMI Lentivirus plasmid
    ORF Viral Vector pGMLP003879 Human NMI Lentivirus plasmid
    ORF Viral Vector vGMLP001279 Human NMI Lentivirus particle
    ORF Viral Vector vGMLP003879 Human NMI Lentivirus particle


    Target information

    Target ID GM-SE1126
    Target Name NMI
    Gene ID 9111, 64685, 694554, 311021, 101100404, 476146, 511280, 100050154
    Gene Symbol and Synonyms NMI
    Uniprot Accession Q13287
    Uniprot Entry Name NMI_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000123609
    Target Classification Not Available

    NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.