Human KLK1/hK1/Klk6 ORF/cDNA clone-Lentivirus plasmid (BC005313)

Cat. No.: pGMLP003923
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KLK1/hK1/Klk6 Lentiviral expression plasmid for KLK1 lentivirus packaging, KLK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to KLK1/hK1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $497.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003923
Gene Name KLK1
Accession Number BC005313
Gene ID 3816
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 789 bp
Gene Alias hK1,Klk6,KLKR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGTTCCTGGTTCTGTGCCTCGCCCTGTCCCTGGGGGGGACTGGTGCTGCGCCCCCGATTCAGTCCCGGATTGTGGGAGGCTGGGAGTGTGAGCAGCATTCCCAGCCCTGGCAGGCGGCTCTGTACCATTTCAGCACTTTCCAGTGTGGGGGCATCCTGGTGCACCGCCAGTGGGTGCTCACAGCTGCTCATTGCATCAGCGACAATTACCAGCTCTGGCTGGGTCGCCACAACTTGTTTGACGACGAAAACACAGCCCAGTTTGTTCATGTCAGTGAGAGCTTCCCACACCCTGGCTTCAACATGAGCCTCCTGGAGAACCACACCCGCCAAGCAGACGAGGACTACAGCCACGACCTCATGCTGCTCCGCCTGACAGAGCCTGCTGATACCATCACAGACGCTGTGAAGGTCGTGGAGTTGCCCACCCAGGAACCCGAAGTGGGGAGCACCTGTTTGGCTTCCGGCTGGGGCAGCATCGAACCAGAGAATTTCTCATTTCCAGATGATCTCCAGTGTGTGGACCTCAAAATCCTGCCTAATGATGAGTGCAAAAAAGTCCACGTCCAGAAGGTGACAGACTTCATGCTGTGTGTCGGACACCTGGAAGGTGGCAAAGACACCTGTGTGGGTGATTCAGGGGGCCCGCTGATGTGTGATGGTGTGCTCCAAGGTGTCACATCATGGGGCTACGTCCCTTGTGGCACCCCCAATAAGCCTTCTGTCGCCGTCAGAGTGCTGTCTTATGTGAAGTGGATCGAGGACACCATAGCGGAGAACTCCTGA
ORF Protein Sequence MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTQEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T40000-Ab Anti-KLK1/ KLKR/ Klk6 functional antibody
    Target Antigen GM-Tg-g-T40000-Ag KLK1 protein
    ORF Viral Vector pGMLP003923 Human KLK1 Lentivirus plasmid
    ORF Viral Vector vGMLP003923 Human KLK1 Lentivirus particle


    Target information

    Target ID GM-T40000
    Target Name KLK1
    Gene ID 3816, 16612, 106994826, 101090062, 403942, 493738, 100147008
    Gene Symbol and Synonyms 0610007D04Rik,hK1,Kal,KAL-B,KLK1,Klk1b6,KLK1E1,Klk6,KLKR,KLNA1,mGk-6
    Uniprot Accession P06870
    Uniprot Entry Name KLK1_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000167748
    Target Classification Not Available

    Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. This protein is functionally conserved in its capacity to release the vasoactive peptide, Lys-bradykinin, from low molecular weight kininogen. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.