Human NIPAL3/DJ462O23.2/NPAL3 ORF/cDNA clone-Lentivirus plasmid (NM_020448)

Cat. No.: pGMLP003959
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NIPAL3/DJ462O23.2/NPAL3 Lentiviral expression plasmid for NIPAL3 lentivirus packaging, NIPAL3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NIPAL3/DJ462O23.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $641.88
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003959
Gene Name NIPAL3
Accession Number NM_020448
Gene ID 57185
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1221 bp
Gene Alias DJ462O23.2,NPAL3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACGGATCCCACAGCGCAGCCCTGAAGCTGCAGCAGCTGCCTCCCACAAGTAGCTCCAGCGCCGTAAGCGAGGCCTCCTTCTCCTACAAGGAAAACCTGATTGGCGCCCTCTTGGCGATCTTCGGGCACCTCGTGGTCAGCATTGCACTTAACCTCCAGAAGTACTGCCACATCCGCCTGGCAGGCTCCAAGGATCCCCGGGCCTATTTCAAGACCAAGACATGGTGGCTGGGCCTGTTCCTGATGCTTCTGGGCGAGCTGGGTGTGTTCGCCTCCTACGCCTTCGCGCCGCTGTCACTCATCGTGCCCCTCAGCGCAGTTTCTGTGATAGCTAGTGCCATCATAGGAATCATATTCATCAAGGAAAAGTGGAAACCGAAAGACTTTCTGAGGCGCTACGTCTTGTCCTTTGTTGGCTGCGGTTTGGCTGTCGTGGGTACCTACCTGCTGGTGACATTCGCACCCAACAGTCACGAGAAGATGACAGGCGAGAATGTCACCAGGCACCTCGTGAGCTGGCCTTTCCTTTTGTACATGCTGGTGGAGATCATTCTGTTCTGCTTGCTGCTCTACTTCTACAAGGAGAAGAACGCCAACAACATTGTCGTGATTCTTCTCTTGGTGGCGTTACTTGGCTCCATGACAGTGGTGACAGTCAAGGCCGTGGCTGGGATGCTTGTCTTGTCCATTCAAGGGAACCTGCAGCTTGACTACCCCATCTTCTACGTGATGTTCGTGTGCATGGTGGCAACCGCCGTCTATCAGGCTGCGTTTTTGAGTCAAGCCTCACAGATGTACGACTCCTCTTTGATTGCCAGTGTGGGCTACATTCTGTCCACAACCATTGCTATCACAGCAGGTGCAATATTTTACCTGGACTTCATCGGGGAGGACGTGCTGCACATCTGCATGTTTGCACTGGGGTGCCTCATTGCATTCTTGGGCGTCTTCTTAATCACGCGTAACAGGAAGAAGCCCATTCCATTTGAGCCCTATATTTCCATGGATGCCATGCCAGGTATGCAGAACATGCACGATAAAGGGATGACTGTCCAGCCTGAACTTAAAGCTTCTTTTTCCTATGGGGCTCTGGAAAACAATGACAACATTTCTGAGATCTACGCTCCTGCCACCCTGCCAGTCATGCAAGAAGAGCACGGCTCCAGAAGTGCCTCTGGGGTCCCCTACCGAGTCCTAGAGCACACCAAGAAGGAATGA
ORF Protein Sequence MDGSHSAALKLQQLPPTSSSSAVSEASFSYKENLIGALLAIFGHLVVSIALNLQKYCHIRLAGSKDPRAYFKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVPLSAVSVIASAIIGIIFIKEKWKPKDFLRRYVLSFVGCGLAVVGTYLLVTFAPNSHEKMTGENVTRHLVSWPFLLYMLVEIILFCLLLYFYKEKNANNIVVILLLVALLGSMTVVTVKAVAGMLVLSIQGNLQLDYPIFYVMFVCMVATAVYQAAFLSQASQMYDSSLIASVGYILSTTIAITAGAIFYLDFIGEDVLHICMFALGCLIAFLGVFLITRNRKKPIPFEPYISMDAMPGMQNMHDKGMTVQPELKASFSYGALENNDNISEIYAPATLPVMQEEHGSRSASGVPYRVLEHTKKE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1270-Ab Anti-NIPAL3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1270-Ag NIPAL3 protein
    ORF Viral Vector pGMLP003959 Human NIPAL3 Lentivirus plasmid
    ORF Viral Vector vGMLP003959 Human NIPAL3 Lentivirus particle


    Target information

    Target ID GM-IP1270
    Target Name NIPAL3
    Gene ID 57185, 74552, 711963, 502990, 101097993, 100856104, 616724, 100071495
    Gene Symbol and Synonyms 9130020G22Rik,DJ462O23.2,NIPAL3,NPAL3,RGD1563439,SLC57A5
    Uniprot Accession Q6P499
    Uniprot Entry Name NPAL3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000001461
    Target Classification Not Available

    Predicted to enable magnesium ion transmembrane transporter activity. Predicted to be involved in magnesium ion transport. Predicted to be integral component of membrane. Predicted to be active in membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.