Human APOC2 ORF/cDNA clone-Lentivirus plasmid (BC005348)
Cat. No.: pGMLP004009
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human APOC2/ Lentiviral expression plasmid for APOC2 lentivirus packaging, APOC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
APOC2/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004009 |
Gene Name | APOC2 |
Accession Number | BC005348 |
Gene ID | 344 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 306 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCACACGACTCCTCCCAGCTCTGTTTCTTGTCCTCCTGGTATTGGGATTTGAGGTCCAGGGGACCCAACAGCCCCAGCAAGATGAGATGCCTAGCCCGACCCTCCTCACCCAGGTGAAGGAATCTCTCTCCAGTTACTGGGAGTCAGCAAAGACAGCCGCCCAGAACCTGTACGAGAAGACATACCTGCCCGCTGTAGATGAGAAACTCAGGGACTTGTACAGCAAAAGCACAGCAGCCATGAGCACTTACACAGGCATTTTTACTGACCAAGTTCTTTCTGTGCTGAAGGGAGAGGAGTAA |
ORF Protein Sequence | MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0673-Ab | Anti-APOC2/ APO-CII/ APOC-II functional antibody |
Target Antigen | GM-Tg-g-SE0673-Ag | APOC2 protein |
ORF Viral Vector | pGMLP003380 | Human APOC2 Lentivirus plasmid |
ORF Viral Vector | pGMLP004009 | Human APOC2 Lentivirus plasmid |
ORF Viral Vector | vGMLP003380 | Human APOC2 Lentivirus particle |
ORF Viral Vector | vGMLP004009 | Human APOC2 Lentivirus particle |
Target information
Target ID | GM-SE0673 |
Target Name | APOC2 |
Gene ID | 344, 11813, 100499578, 292697, 101096861, 442969, 618039, 100065532 |
Gene Symbol and Synonyms | APO-CII,APOC-II,APOC2,APOC4,APOCII,RGD1560725 |
Uniprot Accession | P02655 |
Uniprot Entry Name | APOC2_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Malignant neoplasm of bladder |
Gene Ensembl | ENSG00000234906 |
Target Classification | Not Available |
This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.