Human RGS16/A28-RGS14/A28-RGS14P ORF/cDNA clone-Lentivirus plasmid (BC006243)

Cat. No.: pGMLP004019
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RGS16/A28-RGS14/A28-RGS14P Lentiviral expression plasmid for RGS16 lentivirus packaging, RGS16 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RGS16/A28-RGS14 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $452.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004019
Gene Name RGS16
Accession Number BC006243
Gene ID 6004
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 609 bp
Gene Alias A28-RGS14,A28-RGS14P,RGS-R
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCCGCACCCTGGCCGCCTTCCCCACCACCTGCCTGGAGAGAGCCAAAGAGTTCAAGACACGTCTGGGGATCTTTCTTCACAAATCAGAGCTGGGCTGCGATACTGGGAGTACTGGCAAGTTCGAGTGGGGCAGTAAACACAGCAAAGAGAATAGAAACTTCTCAGAAGATGTGCTGGGGTGGAGAGAGTCGTTCGACCTGCTGCTGAGCAGTAAAAATGGAGTGGCTGCCTTCCACGCTTTCCTGAAGACAGAGTTCAGTGAGGAGAACCTGGAGTTCTGGCTGGCCTGTGAGGAGTTCAAGAAGATCCGATCAGCTACCAAGCTGGCCTCCAGGGCACACCAGATCTTTGAGGAGTTCATTTGCAGTGAGGCCCCTAAAGAGGTCAACATTGACCATGAGACCCGCGAGCTGACGAGGATGAACCTGCAGACTGCCACAGCCACATGCTTTGATGCGGCTCAGGGGAAGACACGTACCCTGATGGAGAAGGACTCCTACCCACGCTTCCTGAAGTCGCCTGCTTACCGGGACCTGGCTGCCCAAGCCTCAGCCGCCTCTGCCACTCTGTCCAGCTGCAGCCTGGACGAGCCCTCACACACCTGA
ORF Protein Sequence MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T52888-Ab Anti-RGS16 monoclonal antibody
    Target Antigen GM-Tg-g-T52888-Ag RGS16 protein
    ORF Viral Vector pGMLP003441 Human RGS16 Lentivirus plasmid
    ORF Viral Vector pGMLP004019 Human RGS16 Lentivirus plasmid
    ORF Viral Vector vGMLP003441 Human RGS16 Lentivirus particle
    ORF Viral Vector vGMLP004019 Human RGS16 Lentivirus particle


    Target information

    Target ID GM-T52888
    Target Name RGS16
    Gene ID 6004, 19734, 715599, 360857, 101092326, 100856402, 282035, 100051514
    Gene Symbol and Synonyms A28-RGS14,A28-RGS14P,RGS-R,Rgs14,RGS16,Rgsr
    Uniprot Accession O15492
    Uniprot Entry Name RGS16_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000143333
    Target Classification Not Available

    The protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.